DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31126 and AT1G55805

DIOPT Version :9

Sequence 1:NP_733027.2 Gene:CG31126 / 326121 FlyBaseID:FBgn0051126 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_564702.2 Gene:AT1G55805 / 842030 AraportID:AT1G55805 Length:160 Species:Arabidopsis thaliana


Alignment Length:130 Identity:46/130 - (35%)
Similarity:67/130 - (51%) Gaps:25/130 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TGVSIRN--LNQLTPTISSLGQILPRATMSQEAGQYPPIESAMRKALNTELKPVYLEVINESPQH 72
            ||...|:  ::.:..|.|..|.|..||             |.||:.|..||:||.|.:.:.|.||
plant    43 TGTGSRSVAMSSVEKTGSDSGAIENRA-------------SRMREKLQKELEPVELVIEDVSYQH 94

  Fly    73 ----NVPKRS--ESHFRVFVVSEKFNDLTLIKRHRLVNDTVKNALKEAGFEFMHALSIEAKTPKQ 131
                .:..|:  |:||.|.:||:.|..:.|:||||||...::..| :.|   :|||||.:|||.:
plant    95 AGHAGMKGRTDDETHFNVKIVSKGFEGMNLVKRHRLVYHLLREEL-DTG---LHALSIVSKTPSE 155

  Fly   132  131
            plant   156  155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31126NP_733027.2 BolA 54..131 CDD:279982 34/82 (41%)
AT1G55805NP_564702.2 BolA 76..155 CDD:396332 34/82 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I4006
eggNOG 1 0.900 - - E1_COG0271
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1603661at2759
OrthoFinder 1 1.000 - - FOG0000905
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101206
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.680

Return to query results.
Submit another query.