DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31126 and CPSUFE

DIOPT Version :10

Sequence 1:NP_733027.2 Gene:CG31126 / 326121 FlyBaseID:FBgn0051126 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_194380.1 Gene:CPSUFE / 828756 AraportID:AT4G26500 Length:371 Species:Arabidopsis thaliana


Alignment Length:90 Identity:36/90 - (40%)
Similarity:52/90 - (57%) Gaps:12/90 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 MRKALNTELKPVYLEVINESPQH--------NVPKRSESHFRVFVVSEKFNDLTLIKRHRLVNDT 106
            :|:.|..||.||.|||.:.|.||        :.....|:||.:.:||:.|...:|:|||||:.|.
plant   285 IREKLEKELDPVELEVEDVSYQHAGHAAVRGSAGDDGETHFNLRIVSDAFQGKSLVKRHRLIYDL 349

  Fly   107 VKNALKEAGFEFMHALSIEAKTPKQ 131
            :::.||..    :|||||.||||.:
plant   350 LQDELKSG----LHALSIVAKTPAE 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31126NP_733027.2 BolA 45..133 CDD:440041 36/90 (40%)
CPSUFENP_194380.1 SufE 83..214 CDD:441769
BolA 284..370 CDD:440041 36/88 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.