powered by:
Protein Alignment CG31126 and bola3
DIOPT Version :9
Sequence 1: | NP_733027.2 |
Gene: | CG31126 / 326121 |
FlyBaseID: | FBgn0051126 |
Length: | 150 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001037940.1 |
Gene: | bola3 / 733564 |
XenbaseID: | XB-GENE-982605 |
Length: | 104 |
Species: | Xenopus tropicalis |
Alignment Length: | 49 |
Identity: | 14/49 - (28%) |
Similarity: | 27/49 - (55%) |
Gaps: | 5/49 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 FRVFVVSEKFNDLTLIKRHRLVNDTVKNALKEAGFEFMHALSIEAKTPK 130
:.:.:.||:|.|...:::|::||:.::..:|. ||.|.|....||
Frog 60 YEIHIESEEFKDKRTVQQHKMVNEALQEEIKA-----MHGLRIFTTAPK 103
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG31126 | NP_733027.2 |
BolA |
54..131 |
CDD:279982 |
14/49 (29%) |
bola3 | NP_001037940.1 |
BolA |
30..104 |
CDD:381986 |
14/49 (29%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.