DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31126 and zgc:112271

DIOPT Version :10

Sequence 1:NP_733027.2 Gene:CG31126 / 326121 FlyBaseID:FBgn0051126 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001230100.1 Gene:zgc:112271 / 553698 ZFINID:ZDB-GENE-050522-443 Length:86 Species:Danio rerio


Alignment Length:87 Identity:30/87 - (34%)
Similarity:50/87 - (57%) Gaps:10/87 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 MRKALNTELKPVYLEVINESPQHNVPKRSESHFRVFVVSEKFNDLTLIKRHRLVNDTVKNALKEA 114
            :||.|..|:..::::|.:.|     |.|..:.|:|.|||.:|....|::|||:||:.:...||| 
Zfish     8 IRKKLIAEIGAIHVDVEDTS-----PSRCAASFKVLVVSPQFEGKQLLQRHRMVNNCLAQELKE- 66

  Fly   115 GFEFMHALSIEAKTPKQWEPEQ 136
                :||...:..||:|||.::
Zfish    67 ----IHAFEQKTLTPEQWEKQK 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31126NP_733027.2 BolA 45..133 CDD:440041 28/82 (34%)
zgc:112271NP_001230100.1 BolA 12..79 CDD:460305 25/76 (33%)

Return to query results.
Submit another query.