DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31126 and CG33672

DIOPT Version :10

Sequence 1:NP_733027.2 Gene:CG31126 / 326121 FlyBaseID:FBgn0051126 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001027413.1 Gene:CG33672 / 3771915 FlyBaseID:FBgn0061360 Length:86 Species:Drosophila melanogaster


Alignment Length:98 Identity:33/98 - (33%)
Similarity:52/98 - (53%) Gaps:17/98 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MSQEAGQYPPIESAMRKALNTELKPVYLEVINESPQHNVPKRSESHFRVFVVSEKFNDLTLIKRH 100
            ||:...:|  :|..:::.|.||    |:.|.:||      ......|...:||..|:..||:::|
  Fly     1 MSKYDSKY--LEEKLKRELQTE----YVSVTDES------DGCGGKFSAVIVSPAFSGKTLLQKH 53

  Fly   101 RLVNDTVKNALKEAGFEFMHALSIEAKTPKQWE 133
            ||||.|:...|||     :||.|.::.||::||
  Fly    54 RLVNSTLAEELKE-----IHAFSQKSYTPEEWE 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31126NP_733027.2 BolA 45..133 CDD:440041 28/87 (32%)
CG33672NP_001027413.1 BolA 1..82 CDD:440041 33/98 (34%)

Return to query results.
Submit another query.