powered by:
Protein Alignment CG31126 and Bola3
DIOPT Version :9
Sequence 1: | NP_733027.2 |
Gene: | CG31126 / 326121 |
FlyBaseID: | FBgn0051126 |
Length: | 150 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001100071.1 |
Gene: | Bola3 / 297388 |
RGDID: | 1305975 |
Length: | 110 |
Species: | Rattus norvegicus |
Alignment Length: | 49 |
Identity: | 14/49 - (28%) |
Similarity: | 26/49 - (53%) |
Gaps: | 5/49 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 FRVFVVSEKFNDLTLIKRHRLVNDTVKNALKEAGFEFMHALSIEAKTPK 130
:.:.:.||:|....::::|::||..:|..:|. ||.|.|....||
Rat 66 YEIKIESEEFKAKRMVQQHQMVNQALKEEIKG-----MHGLRIFTSVPK 109
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG31126 | NP_733027.2 |
BolA |
54..131 |
CDD:279982 |
14/49 (29%) |
Bola3 | NP_001100071.1 |
BolA |
38..109 |
CDD:294273 |
12/47 (26%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0271 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.