DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31126 and SPAC8C9.11

DIOPT Version :9

Sequence 1:NP_733027.2 Gene:CG31126 / 326121 FlyBaseID:FBgn0051126 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_594282.2 Gene:SPAC8C9.11 / 2542160 PomBaseID:SPAC8C9.11 Length:84 Species:Schizosaccharomyces pombe


Alignment Length:83 Identity:22/83 - (26%)
Similarity:41/83 - (49%) Gaps:11/83 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LNTELKPVYLEVINESPQHNVPKRSESHFRVFVVSEKFNDLTLIKRHRLVNDTVKNALKEAGFEF 118
            :...|:|.::|:      .::......:|.|.:||..|...:.:.||||||..::..:|:     
pombe    11 IQNTLEPTHIEI------QDMSGGCGQNFEVIIVSPLFEGKSTLARHRLVNHKLQEVIKD----- 64

  Fly   119 MHALSIEAKTPKQWEPEQ 136
            :||.:.:..:|.|||..|
pombe    65 IHAFTQKCYSPAQWEALQ 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31126NP_733027.2 BolA 54..131 CDD:279982 18/76 (24%)
SPAC8C9.11NP_594282.2 BolA 1..81 CDD:223349 21/80 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0271
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000905
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1811
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.