DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31126 and K11H12.1

DIOPT Version :9

Sequence 1:NP_733027.2 Gene:CG31126 / 326121 FlyBaseID:FBgn0051126 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_499963.1 Gene:K11H12.1 / 176890 WormBaseID:WBGene00019658 Length:108 Species:Caenorhabditis elegans


Alignment Length:106 Identity:45/106 - (42%)
Similarity:62/106 - (58%) Gaps:5/106 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PIESAMRKALNTELKPVYLEVINESPQHNVPKRSESHFRVFVVSEKFNDLTLIKRHRLVNDTVKN 109
            |:...:::.|....:|.:|||..||..|||||.:|.||||.|||::|....:|:||||||..:..
 Worm     8 PVARLLKEKLFAAFQPKHLEVECESHLHNVPKGAEKHFRVQVVSDEFEGKRVIERHRLVNTCLAK 72

  Fly   110 ALKEAGFEFMHALSIEAKTPKQWEPEQEPEKSPPCLGGHGK 150
            .|...    :|||.|:|....:|: .|:.|.||.|.||.||
 Worm    73 ELATT----VHALRIDAIPTSKWD-GQKQEDSPTCRGGFGK 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31126NP_733027.2 BolA 54..131 CDD:279982 34/76 (45%)
K11H12.1NP_499963.1 BolA 19..85 CDD:279982 32/69 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166803
Domainoid 1 1.000 58 1.000 Domainoid score I7211
eggNOG 1 0.900 - - E1_COG0271
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41103
Inparanoid 1 1.050 79 1.000 Inparanoid score I3812
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63424
OrthoDB 1 1.010 - - D1603661at2759
OrthoFinder 1 1.000 - - FOG0000905
OrthoInspector 1 1.000 - - oto17945
orthoMCL 1 0.900 - - OOG6_101206
Panther 1 1.100 - - LDO PTHR46229
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1811
SonicParanoid 1 1.000 - - X3109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.