DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31126 and bola1

DIOPT Version :9

Sequence 1:NP_733027.2 Gene:CG31126 / 326121 FlyBaseID:FBgn0051126 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_012825074.2 Gene:bola1 / 100170577 XenbaseID:XB-GENE-991613 Length:147 Species:Xenopus tropicalis


Alignment Length:103 Identity:58/103 - (56%)
Similarity:74/103 - (71%) Gaps:4/103 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PIESAMRKALNTELKPVYLEVINESPQHNVPKRSESHFRVFVVSEKFNDLTLIKRHRLVNDTVKN 109
            |:|:|:|..|...|||.:|||:|||..|.|||.||:||:|.||||.|...:||:||||||:.:|:
 Frog    34 PVENAIRSKLTETLKPSHLEVLNESYMHAVPKGSETHFKVVVVSESFLGKSLIQRHRLVNELLKD 98

  Fly   110 ALKEAGFEFMHALSIEAKTPKQWEPEQEPEKSPPCLGG 147
            .|  ||  .:|||||:||||:|||......|||.|:||
 Frog    99 EL--AG--PVHALSIQAKTPQQWEENPAISKSPACMGG 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31126NP_733027.2 BolA 54..131 CDD:279982 45/76 (59%)
bola1XP_012825074.2 BolA 43..116 CDD:396332 45/76 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8445
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41103
Inparanoid 1 1.050 109 1.000 Inparanoid score I4757
OMA 1 1.010 - - QHG63424
OrthoDB 1 1.010 - - D1603661at2759
OrthoFinder 1 1.000 - - FOG0000905
OrthoInspector 1 1.000 - - oto102330
Panther 1 1.100 - - LDO PTHR46229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.