DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31126 and bola2

DIOPT Version :9

Sequence 1:NP_733027.2 Gene:CG31126 / 326121 FlyBaseID:FBgn0051126 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001165331.1 Gene:bola2 / 100127777 XenbaseID:XB-GENE-970486 Length:90 Species:Xenopus tropicalis


Alignment Length:89 Identity:30/89 - (33%)
Similarity:47/89 - (52%) Gaps:10/89 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 AMRKALNTELKPVYLEVINESPQHNVPKRSESHFRVFVVSEKFNDLTLIKRHRLVNDTVKNALKE 113
            ::|:.|..||:..::||.:.||.|     ..:.|:|.|||..|....|::||||||..:...|:.
 Frog    11 SLREKLTRELQAEHVEVQDTSPNH-----CSTSFKVLVVSPLFEGKALLQRHRLVNGCLAEELRA 70

  Fly   114 AGFEFMHALSIEAKTPKQWEPEQE 137
                 :||...:..||.||..|::
 Frog    71 -----IHAFEQKTLTPAQWAQEKQ 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31126NP_733027.2 BolA 54..131 CDD:279982 26/76 (34%)
bola2NP_001165331.1 BolA 16..83 CDD:279982 26/76 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000905
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1811
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.