DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC11 and HDA1

DIOPT Version :9

Sequence 1:NP_001247296.1 Gene:HDAC11 / 326120 FlyBaseID:FBgn0051119 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_014377.1 Gene:HDA1 / 855710 SGDID:S000004966 Length:706 Species:Saccharomyces cerevisiae


Alignment Length:313 Identity:73/313 - (23%)
Similarity:130/313 - (41%) Gaps:59/313 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HPFDAAKGKHIHKLLCAQLQLDDGSFYEPT-----------------ELTKDQLRRIHTREYLKS 98
            ||.|..:...|:|:|.     ::|...:||                 ..|.:::..:||:|:|:.
Yeast    83 HPEDPRRIYRIYKILA-----ENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEF 142

  Fly    99 LRWSMNVA---CIAEVPLMAFVPNRYIQRSYLRPMRFQAAGSILAGKLALD----YGWAINLGGG 156
            :..:..::   .:.|......|   |.........|....|:|.|.|..::    ...|:....|
Yeast   143 IESTEKMSREELLKETEKGDSV---YFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPG 204

  Fly   157 FHHCCSYRGGGFCPYADISLLIVRLFEQEPFRVRRIMIVDLDAHQGNGHERDF-NNVAAVYI--- 217
             ||......||||.::::::....:.:..|..||||||:|.|.|.|||.::.| .:...:|:   
Yeast   205 -HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLH 268

  Fly   218 -FDM---YNAFV---YPRDHVAK-ESIRCAVELRNYT------EDGFYLRQLKRCLMQSLAEFRP 268
             |:|   |...:   |.:....| |...|     |.|      .|..|:...::.:|....||:|
Yeast   269 RFEMGKYYPGTIQGQYDQTGEGKGEGFNC-----NITWPVGGVGDAEYMWAFEQVVMPMGREFKP 328

  Fly   269 DMVVYNAGTDVLEGDPLGNLAISAEGVIERDRLVFSTFRALGIPVVMLLSGGY 321
            |:|:.::|.|..:||.:|...::.........::.|..|.   .:.::|.|||
Yeast   329 DLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARG---NLCVVLEGGY 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC11NP_001247296.1 HDAC_classIV 51..336 CDD:212519 73/313 (23%)
HDA1NP_014377.1 HDAC_Clr3 81..403 CDD:212542 73/313 (23%)
Arb2 457..698 CDD:401634
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.