DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC11 and Hdac1l

DIOPT Version :9

Sequence 1:NP_001247296.1 Gene:HDAC11 / 326120 FlyBaseID:FBgn0051119 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_445898.1 Gene:Hdac1l / 84576 RGDID:619975 Length:484 Species:Rattus norvegicus


Alignment Length:302 Identity:75/302 - (24%)
Similarity:125/302 - (41%) Gaps:55/302 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HPFDAAKGKHIHKLLCAQLQLDDGSF-----YEPTELTKDQLRRIHTREYLKSLRWSMNVACIAE 110
            ||....:.:..|.||     |:.|.:     |.|.:...:::.:.|:.:|:|.|| |:....::|
  Rat    28 HPMKPHRIRMTHNLL-----LNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLR-SIRPDNMSE 86

  Fly   111 VPLMAFVPNRYIQR-----------SYLRPMRFQAAGSILA----GKLALDYGWAINLGGGFHHC 160
            .       ::.:||           ......:....||:.:    .|...|.  |:|..||.|:.
  Rat    87 Y-------SKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDI--AVNWAGGLHYA 142

  Fly   161 CSYRGGGFCPYADISLLIVRLFEQEPFRVRRIMIVDLDAHQGNGH--ERDFNNVAAVYI--FDMY 221
            ......|||...||.|.|:.|.:..    :|::.:|:|.|.|:|.  |..|.....|..  |..|
  Rat   143 KKSEASGFCYVNDIVLAILELLKYH----QRVLYIDIDIHHGDGDGVEEAFYTTDRVMTVSFHKY 203

  Fly   222 NAFVYP-----RDHVAKESIRCAVE--LRNYTEDGFYLRQLKRCLMQSLAEFRPDMVVYNAGTDV 279
            ..: :|     ||..|.:....||.  ||:..:|..|....|..:.:.:..|:|..||...|:|.
  Rat   204 GEY-FPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDS 267

  Fly   280 LEGDPLGNLAISAEGVIERDRLVFSTFRALGIPVVMLLSGGY 321
            |.||.||...::.:|..:....|    ::..:|::||...||
  Rat   268 LSGDRLGCFNLTIKGHAKCVEFV----KSFNLPMLMLGGDGY 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC11NP_001247296.1 HDAC_classIV 51..336 CDD:212519 75/302 (25%)
Hdac1lNP_445898.1 HDAC1 4..376 CDD:212534 75/302 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.