DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC11 and Hdac7

DIOPT Version :9

Sequence 1:NP_001247296.1 Gene:HDAC11 / 326120 FlyBaseID:FBgn0051119 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_036015418.1 Gene:Hdac7 / 56233 MGIID:1891835 Length:977 Species:Mus musculus


Alignment Length:211 Identity:60/211 - (28%)
Similarity:94/211 - (44%) Gaps:31/211 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 AAGSI--LAGKLA---LDYGWAINLGGGFHHCCSYRGGGFCPYADISLLIVRLFEQEPFRVRRIM 193
            ||||:  ||.|:|   |..|:|:....| ||.......|||.:..:::...:|  |:..:..:|:
Mouse   667 AAGSVTDLAFKVASRELKNGFAVVRPPG-HHADHSTAMGFCFFNSVAIACRQL--QQHGKASKIL 728

  Fly   194 IVDLDAHQGNGHERDFNNVAAVYIFDMY---NAFVYPRDHVAKE-----------SIRCAVELRN 244
            |||.|.|.|||.::.|....:|....::   :...:|......|           ::..|..|..
Mouse   729 IVDWDVHHGNGTQQTFYQDPSVLYISLHRHDDGNFFPGSGAVDEVGTGSGEGFNVNVAWAGGLDP 793

  Fly   245 YTEDGFYLRQLKRCLMQSLAEFRPDMVVYNAGTDVLEGD--PLGNLAISAE--GVIERDRLVFST 305
            ...|..||...:..:|....||.||:|:.:||.|..||.  |||...:||:  |.:.:..:    
Mouse   794 PMGDPEYLAAFRIVVMPIAREFAPDLVLVSAGFDAAEGHPAPLGGYHVSAKCFGYMTQQLM---- 854

  Fly   306 FRALGIPVVMLLSGGY 321
             ...|..||:.|.||:
Mouse   855 -NLAGGAVVLALEGGH 869

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC11NP_001247296.1 HDAC_classIV 51..336 CDD:212519 60/211 (28%)
Hdac7XP_036015418.1 PHA03247 <124..527 CDD:223021
HDAC7 546..921 CDD:212532 60/211 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.