DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC11 and hdac3

DIOPT Version :9

Sequence 1:NP_001247296.1 Gene:HDAC11 / 326120 FlyBaseID:FBgn0051119 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001016883.1 Gene:hdac3 / 549637 XenbaseID:XB-GENE-481106 Length:428 Species:Xenopus tropicalis


Alignment Length:307 Identity:83/307 - (27%)
Similarity:125/307 - (40%) Gaps:66/307 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HPFDAAKGKHIHKL-LCAQLQLDDGSF-----YEPTELTKDQLRRIHTREYL------------- 96
            ||...      |:| |...|.|..|.:     ::|.:.::..:.|.|:.:|:             
 Frog    22 HPMKP------HRLSLTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPNNMQG 80

  Fly    97 --KSLRWSMNVA--CIAEVPLMAFVPNRYIQRSYLRPMRFQAAGSILAGKLALD---YGWAINLG 154
              |||. :.||.  |.....|..|. :||             .|:.|.|...|:   ...|||..
 Frog    81 FTKSLN-AFNVGDDCPVFPGLFEFC-SRY-------------TGASLQGATQLNNKICDIAINWA 130

  Fly   155 GGFHHCCSYRGGGFCPYADISLLIVRLFEQEPFRVRRIMIVDLDAHQGNGHERDF---NNVAAVY 216
            ||.||...:...|||...||.:.|:.|.:..|    |::.||:|.|.|:|.:..|   :.|..| 
 Frog   131 GGLHHAKKFEASGFCYVNDIVIGILELLKYHP----RVLYVDIDIHHGDGVQEAFYLTDRVMTV- 190

  Fly   217 IFDMYNAFVYPRD----HVAKESIR--CA-VELRNYTEDGFYLRQLKRCLMQSLAEFRPDMVVYN 274
            .|..|..:.:|..    .|..||.|  |. |.||:..:|..|....:..:.|.:..::|..:|..
 Frog   191 SFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYRHLFQPVIKQVIDFYQPTCIVLQ 255

  Fly   275 AGTDVLEGDPLGNLAISAEGVIERDRLVFSTFRALGIPVVMLLSGGY 321
            .|.|.|..|.||...:|..|..|..:.|    ::..||:::|..|||
 Frog   256 CGADSLGCDRLGCFNLSIRGHGECVQYV----KSFNIPLLVLGGGGY 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC11NP_001247296.1 HDAC_classIV 51..336 CDD:212519 83/307 (27%)
hdac3NP_001016883.1 HDAC3 3..383 CDD:212529 83/307 (27%)
Histone deacetylase 3..316 83/307 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 386..428
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.