DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC11 and HDAC3

DIOPT Version :9

Sequence 1:NP_001247296.1 Gene:HDAC11 / 326120 FlyBaseID:FBgn0051119 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_651978.2 Gene:HDAC3 / 44446 FlyBaseID:FBgn0025825 Length:438 Species:Drosophila melanogaster


Alignment Length:290 Identity:72/290 - (24%)
Similarity:114/290 - (39%) Gaps:57/290 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IHKLLCAQLQLDDGSFYEPTELTKDQLRRIHTREYLKSLR--WSMNVACIAEVPLMAFVPNRYIQ 123
            :||.:         ..|.|.:.:...:.|.|:.||:..|:  ...|:.|           |....
  Fly    42 LHKKM---------KIYRPYKASAQDMLRFHSDEYIAYLQQVTPQNIQC-----------NSVAY 86

  Fly   124 RSYLRPMR-------------FQA--AGSILAGKLALDYGWA---INLGGGFHHCCSYRGGGFCP 170
            ..||....             |.|  .|:.|.|...|::..:   ||..||.||...:...|||.
  Fly    87 TKYLAHFSVGEDCPVFDGLFDFCAMYTGASLEGAQKLNHNHSDICINWSGGLHHAKKFEASGFCY 151

  Fly   171 YADISLLIVRLFEQEPFRVRRIMIVDLDAHQGNGHERDFNNVAAVYI--FDMYNAFVYPRD---- 229
            ..||.:.|:.|.:..|    |::.:|:|.|.|:|.:..|.....|..  |..|..:.:|..    
  Fly   152 VNDIVIGILELLKYHP----RVLYIDIDVHHGDGVQEAFYLTDRVMTASFHKYGNYFFPGTGDMY 212

  Fly   230 HVAKESIR---CAVELRNYTEDGFYLRQLKRCLMQSLAEFRPDMVVYNAGTDVLEGDPLGNLAIS 291
            .:..||.|   ..|.|:...:|..|.:..|..:...:..:||..:|...|.|.|.||.||..::|
  Fly   213 EIGAESGRYYSVNVPLKEGIDDQSYFQVFKPIISAIMDFYRPTAIVLQCGADSLAGDRLGCFSLS 277

  Fly   292 AEGVIERDRLVFSTFRALGIPVVMLLSGGY 321
            .:|..|..:.|    :.|.:|.:::..|||
  Fly   278 TKGHGECVKFV----KELNVPTLVVGGGGY 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC11NP_001247296.1 HDAC_classIV 51..336 CDD:212519 72/290 (25%)
HDAC3NP_651978.2 HDAC3 4..388 CDD:212529 72/290 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458020
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48252
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.