DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC11 and HDAC1

DIOPT Version :9

Sequence 1:NP_001247296.1 Gene:HDAC11 / 326120 FlyBaseID:FBgn0051119 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster


Alignment Length:303 Identity:84/303 - (27%)
Similarity:128/303 - (42%) Gaps:59/303 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HPFDAAKGKHIHKLLCAQLQLDDGSF-----YEPTELTKDQLRRIHTREYLKSLRWSMNVACIAE 110
            ||....:.:..|.||     |:.|.:     |.|.:.|.|::.:.|:.||::.|| |:....::|
  Fly    26 HPMKPHRIRMTHNLL-----LNYGLYRKMEIYRPHKATADEMTKFHSDEYVRFLR-SIRPDNMSE 84

  Fly   111 VPLMAFVPNRYIQRSYLR---PM--------RFQAAGSILA----GKLALDYGWAINLGGGFHHC 160
            .       |:.:||..:.   |:        :..|.||:.|    .|.|.:.  .||.|||.||.
  Fly    85 Y-------NKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNKQASEI--CINWGGGLHHA 140

  Fly   161 CSYRGGGFCPYADISLLIVRLFEQEPFRVRRIMIVDLDAHQGNGHERDFNNVAAVYI--FDMYNA 223
            ......|||...||.|.|:.|.:..    :|::.:|:|.|.|:|.|..|.....|..  |..|..
  Fly   141 KKSEASGFCYVNDIVLGILELLKYH----QRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGE 201

  Fly   224 FVYP-----RDHVAKESIRCAVE--LRNYTEDGFYLRQLKRCLMQSLAEFRPDMVVYNAGTDVLE 281
            : :|     ||..|.:....||.  ||:..:|..|.......:.:.:..|:|..||...|.|.|.
  Fly   202 Y-FPGTGDLRDIGAGKGKYYAVNIPLRDGMDDDAYESIFVPIISKVMETFQPAAVVLQCGADSLT 265

  Fly   282 GDPLG--NLAISAEG-VIERDRLVFSTFRALGIPVVMLLSGGY 321
            ||.||  ||.:...| .:|       ..:...:|.:|:..|||
  Fly   266 GDRLGCFNLTVKGHGKCVE-------FVKKYNLPFLMVGGGGY 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC11NP_001247296.1 HDAC_classIV 51..336 CDD:212519 84/303 (28%)
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:388375 84/303 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458019
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48252
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.