DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC11 and Hdac4

DIOPT Version :9

Sequence 1:NP_001247296.1 Gene:HDAC11 / 326120 FlyBaseID:FBgn0051119 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_008765500.1 Gene:Hdac4 / 363287 RGDID:619979 Length:1096 Species:Rattus norvegicus


Alignment Length:360 Identity:75/360 - (20%)
Similarity:129/360 - (35%) Gaps:105/360 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 HHEEQESEEVVWVKRDDARSAGKLPIVFSRNYAVRFGGLERLHPFDAAKGKHIHKLLCAQLQLDD 73
            |.|.....:.:|.:..:....||...:..|...:.  .|:.:|       ...|.||        
  Rat   687 HPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLE--ELQTVH-------SEAHTLL-------- 734

  Fly    74 GSFYEPTELTKDQLRRIHTREYLKSLR------------------WS---------MNVACIAEV 111
               |....|.:   :::.:::.|.||.                  |:         :.|.|:.|:
  Rat   735 ---YGTNPLNR---QKLDSKKLLGSLTSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVVEL 793

  Fly   112 PLMAFVPNRYIQRSYLRPMRFQAAGSILAGKLALDYGWAINLGGGFHHCCSYRGGGFCPYADISL 176
            ..                       .:..|:  |..|:|:....| ||.......|||.:..:::
  Rat   794 VF-----------------------KVATGE--LKNGFAVVRPPG-HHAEESTPMGFCYFNSVAI 832

  Fly   177 LIVRLFEQEPFRVRRIMIVDLDAHQGNGHERDFNN-----VAAVYIFDMYNAFVYPRDHVAKE-- 234
            ....|  |:...|.:|:|||.|.|.|||.::.|.|     ..:::.:|..|.|  |......|  
  Rat   833 AAKLL--QQRLNVSKILIVDWDVHHGNGTQQAFYNDPNVLYMSLHRYDDGNFF--PGSGAPDEVG 893

  Fly   235 -------SIRCAVE--LRNYTEDGFYLRQLKRCLMQSLAEFRPDMVVYNAGTDVLEG--DPLGNL 288
                   ::..|..  |.....|..||...:..:|....||.||:|:.::|.|.:||  .|||..
  Rat   894 TGPGVGFNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGY 958

  Fly   289 AISAE--GVIERDRLVFSTFRALGIPVVMLLSGGY 321
            .:||:  |.:.:..:..:     |..:|:.|.||:
  Rat   959 NLSAKCFGYLTKQLMGLA-----GGRIVLALEGGH 988

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC11NP_001247296.1 HDAC_classIV 51..336 CDD:212519 68/318 (21%)
Hdac4XP_008765500.1 ClassIIa_HDAC4_Gln-rich-N <99..160 CDD:197398
HDAC4 661..1069 CDD:212530 75/360 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.