DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC11 and hdac10

DIOPT Version :9

Sequence 1:NP_001247296.1 Gene:HDAC11 / 326120 FlyBaseID:FBgn0051119 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_021326130.1 Gene:hdac10 / 327253 ZFINID:ZDB-GENE-030131-5464 Length:723 Species:Danio rerio


Alignment Length:304 Identity:73/304 - (24%)
Similarity:125/304 - (41%) Gaps:68/304 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 ELTKDQLRRIHTREYLKSLRWS--MNVACIAEVPLMAF---VPNRYIQRSYLRPMRFQAAGSIL- 139
            :.|:.::...|:.|||::::.:  |||.     .||||   ..:.|..::.....:. |||:.| 
Zfish   104 QATEQEILLAHSEEYLEAVKQTPGMNVE-----ELMAFSKKYNDVYFHQNIYHCAKL-AAGATLQ 162

  Fly   140 ----AGKLALDYGWAINLGGGFHHCCSYRGGGFCPYADISLLIVRLFEQEPFRVRRIMIVDLDAH 200
                ..|..:..|.|:....| ||.......|||.:.:::  |..|:.::.:.:.||:|||.|.|
Zfish   163 LVDSVMKREVRNGMALVRPPG-HHSQRSAANGFCVFNNVA--IAALYAKKNYNLNRILIVDWDVH 224

  Fly   201 QGNGHERDFNNVAAVYIFDMYNAFVYPRDHVAKESIRCAVELRNYTE------DGF--------- 250
            .|.|.:..|....:|..|..:.     .:|   :|....:...:|:.      .||         
Zfish   225 HGQGIQYCFEEDPSVLYFSWHR-----YEH---QSFWPNLPESDYSSVGKGKGSGFNINLPWNKV 281

  Fly   251 ------YLRQLKRCLMQSLAEFRPDMVVYNAGTDVLEGDPLGNLAISAEGVIERDRLVFSTFRAL 309
                  ||......|:....||.|::|:.:||.|...|||.|.:....|        :|:....|
Zfish   282 GMTNSDYLAAFFHVLLPVAYEFDPELVIVSAGFDSAIGDPEGEMCALPE--------IFAHLTHL 338

  Fly   310 GIPVV-----MLLSGGYLKASAG-VITDSIVNL------RLQGL 341
            .:|:.     ::|.|||...|.| .:..::.:|      |:.||
Zfish   339 LMPLAAGKMCVVLEGGYNLTSLGQSVCQTVHSLLGDPTPRISGL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC11NP_001247296.1 HDAC_classIV 51..336 CDD:212519 69/291 (24%)
hdac10XP_021326130.1 HDAC10 68..404 CDD:212546 73/304 (24%)
Arginase_HDAC <607..717 CDD:327367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.