DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC11 and HDAC1

DIOPT Version :9

Sequence 1:NP_001247296.1 Gene:HDAC11 / 326120 FlyBaseID:FBgn0051119 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_004955.2 Gene:HDAC1 / 3065 HGNCID:4852 Length:482 Species:Homo sapiens


Alignment Length:300 Identity:77/300 - (25%)
Similarity:126/300 - (42%) Gaps:53/300 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HPFDAAKGKHIHKLLCAQLQLDDGSF-----YEPTELTKDQLRRIHTREYLKSLRWSMNVACIAE 110
            ||....:.:..|.||     |:.|.:     |.|.:...:::.:.|:.:|:|.|| |:....::|
Human    28 HPMKPHRIRMTHNLL-----LNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLR-SIRPDNMSE 86

  Fly   111 VPLMAFVPNRYIQR-----------SYLRPMRFQAAGSILA----GKLALDYGWAINLGGGFHHC 160
            .       ::.:||           ......:....||:.:    .|...|.  |:|..||.||.
Human    87 Y-------SKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDI--AVNWAGGLHHA 142

  Fly   161 CSYRGGGFCPYADISLLIVRLFEQEPFRVRRIMIVDLDAHQGNGHERDFNNVAAVYI--FDMYNA 223
            ......|||...||.|.|:.|.:..    :|::.:|:|.|.|:|.|..|.....|..  |..|..
Human   143 KKSEASGFCYVNDIVLAILELLKYH----QRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGE 203

  Fly   224 FVYP-----RDHVAKESIRCAVE--LRNYTEDGFYLRQLKRCLMQSLAEFRPDMVVYNAGTDVLE 281
            : :|     ||..|.:....||.  ||:..:|..|....|..:.:.:..|:|..||...|:|.|.
Human   204 Y-FPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLS 267

  Fly   282 GDPLGNLAISAEGVIERDRLVFSTFRALGIPVVMLLSGGY 321
            ||.||...::.:|..:....|    ::..:|::||..|||
Human   268 GDRLGCFNLTIKGHAKCVEFV----KSFNLPMLMLGGGGY 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC11NP_001247296.1 HDAC_classIV 51..336 CDD:212519 76/299 (25%)
HDAC1NP_004955.2 HDAC1 4..374 CDD:212534 76/299 (25%)
Histone deacetylase 9..321 76/299 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 390..482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.