DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC11 and hdac1

DIOPT Version :9

Sequence 1:NP_001247296.1 Gene:HDAC11 / 326120 FlyBaseID:FBgn0051119 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_005159649.1 Gene:hdac1 / 192302 ZFINID:ZDB-GENE-020419-32 Length:484 Species:Danio rerio


Alignment Length:308 Identity:77/308 - (25%)
Similarity:121/308 - (39%) Gaps:69/308 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HPFDAAKGKHIHKLLCAQLQLDDGSF-----YEPTELTKDQLRRIHTREYLKSLRWSMNVACIAE 110
            ||....:.:..|.||     |:.|.:     |.|.:...:::.:.|:.:|:|.||          
Zfish    29 HPMKPHRIRMTHNLL-----LNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLR---------- 78

  Fly   111 VPLMAFVPNRYIQRSYLRPM-RF----------------------QAAGSILAGKLALDYGWAIN 152
                :..|:.  ...|.:.| ||                      ..||::...|...|.  |||
Zfish    79 ----SIRPDN--MSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNKQQTDI--AIN 135

  Fly   153 LGGGFHHCCSYRGGGFCPYADISLLIVRLFEQEPFRVRRIMIVDLDAHQGNGHERDFNNVAAVYI 217
            ..||.||.......|||...||.|.|:.|.:..    :|::.:|:|.|.|:|.|..|.....|..
Zfish   136 WAGGLHHAKKSEASGFCYVNDIVLAILELLKYH----QRVLYIDIDIHHGDGVEEAFYTTDRVMT 196

  Fly   218 --FDMYNAFVYP-----RDHVAKESIRCAVE--LRNYTEDGFYLRQLKRCLMQSLAEFRPDMVVY 273
              |..|..: :|     ||..|.:....||.  ||:..:|..|....|..:.:.:..::|..||.
Zfish   197 VSFHKYGEY-FPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPIMSKVMEMYQPSAVVL 260

  Fly   274 NAGTDVLEGDPLGNLAISAEGVIERDRLVFSTFRALGIPVVMLLSGGY 321
            ..|.|.|.||.||...::.:|..:    .....::..:|::||..|||
Zfish   261 QCGADSLSGDRLGCFNLTIKGHAK----CVEYMKSFNLPLLMLGGGGY 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC11NP_001247296.1 HDAC_classIV 51..336 CDD:212519 77/308 (25%)
hdac1XP_005159649.1 HDAC1 5..375 CDD:212534 77/308 (25%)
PTZ00063 8..406 CDD:240251 77/308 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.