DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC11 and hda-2

DIOPT Version :9

Sequence 1:NP_001247296.1 Gene:HDAC11 / 326120 FlyBaseID:FBgn0051119 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_495678.1 Gene:hda-2 / 174285 WormBaseID:WBGene00001835 Length:507 Species:Caenorhabditis elegans


Alignment Length:224 Identity:60/224 - (26%)
Similarity:93/224 - (41%) Gaps:33/224 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 AGSILAGKLALDYGW---AINLGGGFHHCCSYRGGGFCPYADISLLIVRLFEQEPFRVRRIMIVD 196
            ||..:.|...|::..   .||..||.||.......|||...||.|.|:.|.:..    :|::.:|
 Worm   135 AGGSVEGARRLNHKMNDIVINWPGGLHHAKKSEASGFCYVNDIVLGILELLKYH----KRVLYID 195

  Fly   197 LDAHQGNGHERDFNN-----VAAVYIFDMY--------NAFVYPRDHVAKESIRCAVELRNYTED 248
            :|.|.|:|.:..|||     ..:.:.|..|        :..|.|..:.|     ..|.|.....|
 Worm   196 IDIHHGDGVQEAFNNSDRVMTVSFHRFGQYFPGSGSIMDKGVGPGKYFA-----INVPLMAAIRD 255

  Fly   249 GFYLRQLKRCLMQSLAEFRPDMVVYNAGTDVLEGDPLGNLAISAEGVIERDRLVFSTFRALGIPV 313
            ..||:..:..:......|.|:.:|...|:|.|..|.||..|:|........:.|    ::||.|:
 Worm   256 EPYLKLFESVISGVEENFNPEAIVLQCGSDSLCEDRLGQFALSFNAHARAVKYV----KSLGKPL 316

  Fly   314 VMLLSGGYLKASA----GVITDSIVNLRL 338
            ::|..|||...:.    .:.|..|:.||:
 Worm   317 MVLGGGGYTLRNVARCWALETGVILGLRM 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC11NP_001247296.1 HDAC_classIV 51..336 CDD:212519 58/220 (26%)
hda-2NP_495678.1 PTZ00063 28..430 CDD:240251 60/224 (27%)
Arginase_HDAC 29..406 CDD:302587 60/224 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.