DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC11 and Hdac2

DIOPT Version :9

Sequence 1:NP_001247296.1 Gene:HDAC11 / 326120 FlyBaseID:FBgn0051119 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_032255.2 Gene:Hdac2 / 15182 MGIID:1097691 Length:488 Species:Mus musculus


Alignment Length:309 Identity:81/309 - (26%)
Similarity:127/309 - (41%) Gaps:71/309 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HPFDAAKGKHIHKLLCAQLQLDDGSF-----YEPTELTKDQLRRIHTREYLKSLRWSMNVACIAE 110
            ||....:.:..|.||     |:.|.:     |.|.:.|.:::.:.|:.||:|.||          
Mouse    29 HPMKPHRIRMTHNLL-----LNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLR---------- 78

  Fly   111 VPLMAFVPNRYIQRSYLRPM-RFQ-----------------AAGSILAGKLALD---YGWAINLG 154
                :..|:.  ...|.:.| ||.                 :.|..:||.:.|:   ...|:|..
Mouse    79 ----SIRPDN--MSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWA 137

  Fly   155 GGFHHCCSYRGGGFCPYADISLLIVRLFEQEPFRVRRIMIVDLDAHQGNGHERDFNNVAAVYI-- 217
            ||.||.......|||...||.|.|:.|.:..    :|::.:|:|.|.|:|.|..|.....|..  
Mouse   138 GGLHHAKKSEASGFCYVNDIVLAILELLKYH----QRVLYIDIDIHHGDGVEEAFYTTDRVMTVS 198

  Fly   218 FDMYNAFVYP-----RDHVAKESIRCAVE--LRNYTEDGFYLRQLKRCLMQSLAEFRPDMVVYNA 275
            |..|..: :|     ||..|.:....||.  :|:..:|..|.:..|..:.:.:..::|..||...
Mouse   199 FHKYGEY-FPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQC 262

  Fly   276 GTDVLEGDPLGNLAISAEG---VIERDRLVFSTFRALGIPVVMLLSGGY 321
            |.|.|.||.||...::.:|   .:|    |..||   .:|::||..|||
Mouse   263 GADSLSGDRLGCFNLTVKGHAKCVE----VVKTF---NLPLLMLGGGGY 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC11NP_001247296.1 HDAC_classIV 51..336 CDD:212519 81/309 (26%)
Hdac2NP_032255.2 PTZ00063 9..398 CDD:240251 81/309 (26%)
HDAC2 9..374 CDD:212535 81/309 (26%)
Histone deacetylase 9..322 81/309 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..488
DUF4604 391..486 CDD:292021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.