DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC11 and hdac12

DIOPT Version :9

Sequence 1:NP_001247296.1 Gene:HDAC11 / 326120 FlyBaseID:FBgn0051119 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_001920667.4 Gene:hdac12 / 100148903 ZFINID:ZDB-GENE-131121-613 Length:354 Species:Danio rerio


Alignment Length:306 Identity:96/306 - (31%)
Similarity:142/306 - (46%) Gaps:45/306 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LPIVFSRNYAVRF-GGLERLHPFDAAKGKHIHKLLCAQLQLDDGSFYEPTELTKDQLRRIHTREY 95
            ||||    :.|:| ..|...|.|...|...|.:.|.....:.|...:.|...:::.||.:||.||
Zfish    51 LPIV----HHVKFICELPENHRFPMLKFPKILESLLRDQAITDKQVWAPKIASEELLRCVHTEEY 111

  Fly    96 LKS---------------LRWSMNVACIAEVPLMAFVPNRYIQRSYLRPMRFQAAGSILAGKLAL 145
            |.:               ..||..:                :||     .|::..|::|||::||
Zfish   112 LSNFISGKISEKDQKRSGFPWSSGL----------------VQR-----CRYETGGTLLAGQIAL 155

  Fly   146 DYGWAINLGGGFHHCCSYRGGGFCPYADISLLIVRLFEQEPFRVRRIMIVDLDAHQGNGHERDFN 210
            ..|.|.:..||.||.....|.|||...|:::....|. .||...|:|:|||||.|||:|....|.
Zfish   156 QRGLACSTAGGTHHAFPSHGSGFCLLNDLAVTAKHLI-SEPTPKRKILIVDLDVHQGDGTAFIFK 219

  Fly   211 NVAAVYIFDMYNAFVYPRDHVAKESIRCAVELRNYTEDGFYLRQLKRCLMQSLAEFRPDMVVYNA 275
            :..:|:.|.::....:|   :.|:.....|.|.:.|||..||.:::..|...|..||||:|:|::
Zfish   220 DEPSVFTFSVHCQRNFP---LRKQQSDLDVSLEDGTEDREYLSRVQEHLPWLLESFRPDLVLYDS 281

  Fly   276 GTDVLEGDPLGNLAISAEGVIERDRLVFSTFRALGIPVVMLLSGGY 321
            |.|....|.||.|.::.||:..||..|..|....||||..::.|||
Zfish   282 GVDPHWDDELGKLRLTDEGLYRRDLYVLHTVVKSGIPVATVIGGGY 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC11NP_001247296.1 HDAC_classIV 51..336 CDD:212519 89/286 (31%)
hdac12XP_001920667.4 HDAC_classIV 67..342 CDD:212519 89/286 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037375at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103672
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.