DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB11 and ANNAT8

DIOPT Version :9

Sequence 1:NP_001259616.1 Gene:AnxB11 / 32612 FlyBaseID:FBgn0030749 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_568271.2 Gene:ANNAT8 / 831113 AraportID:AT5G12380 Length:316 Species:Arabidopsis thaliana


Alignment Length:326 Identity:101/326 - (30%)
Similarity:170/326 - (52%) Gaps:33/326 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 TVVPAANFDAVKDAHDLRKAMKGFGTDEDALINIICRRSNEQRQEIQRQFKTHFGKDLIEDIKSE 261
            |:|...:|..|:||.:::.|.:|:||:|:|:|:|:..|:..||:.|::.::..:.:|||..:|||
plant     3 TIVSPPHFSPVEDAENIKAACQGWGTNENAIISILGHRNLFQRKLIRQAYQEIYHEDLIHQLKSE 67

  Fly   262 TSGNFEKLL----------------VGLLRPIVDYYCAELNDAMAGLGTDEEVLIEILCTLSNME 310
            .|||||:.:                :.|.:||.||                :||:||.|..|..:
plant    68 LSGNFERAICLWVLDPPERDALLANLALQKPIPDY----------------KVLVEIACMRSPED 116

  Fly   311 INTIKNQYLRLYGAHLESELKSETSGNFKRLLTSLCTAARDESGRVDPVAAKNDARELLKAGELR 375
            :...:..|..||...||.:|.|.|.|:.:|||.::.:|.:.:...:|.:.|:::| .:|....|.
plant   117 MLAARRAYRCLYKHSLEEDLASRTIGDIRRLLVAMVSAYKYDGEEIDEMLAQSEA-AILHDEILG 180

  Fly   376 VGTDESMFNMILCQRNYQQLKLIFQEYEGMTGHSLEKAIKKEFSGDVMEGLIAIYRCVTNKAEYF 440
            ...|......:|..|:..||..||..|:.:.|.|:.|.:....:.:.:..|.|..||:.|...|:
plant   181 KAVDHEETIRVLSTRSSMQLSAIFNRYKDIYGTSITKDLLNHPTNEYLSALRAAIRCIKNPTRYY 245

  Fly   441 ASRLHKAMAGIGTNDTQLIRVIITRSEIDMTDIKVAFERLYGKSLKSWIKGDTSGHYKHALYALV 505
            |..|..::..:||::..|.|||:||:|.|:|:|...:.:....||...|..:|||.||..|.||:
plant   246 AKVLRNSINTVGTDEDALNRVIVTRAEKDLTNITGLYFKRNNVSLDQAIAKETSGDYKAFLLALL 310

  Fly   506 G 506
            |
plant   311 G 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB11NP_001259616.1 Annexin 209..273 CDD:278615 25/79 (32%)
Annexin 280..345 CDD:278615 19/64 (30%)
Annexin 364..429 CDD:278615 15/64 (23%)
Annexin 439..504 CDD:278615 24/64 (38%)
ANNAT8NP_568271.2 Annexin 15..79 CDD:395139 25/63 (40%)
ANX 101..151 CDD:197661 20/65 (31%)
Annexin 171..233 CDD:413385 15/62 (24%)
Annexin 244..309 CDD:395139 24/64 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I3988
eggNOG 1 0.900 - - E1_KOG0819
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I1373
OMA 1 1.010 - - QHG54302
OrthoDB 1 1.010 - - D856254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm965
orthoMCL 1 0.900 - - OOG6_100522
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X76
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.