DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB11 and ANNAT4

DIOPT Version :9

Sequence 1:NP_001259616.1 Gene:AnxB11 / 32612 FlyBaseID:FBgn0030749 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_181409.1 Gene:ANNAT4 / 818457 AraportID:AT2G38750 Length:319 Species:Arabidopsis thaliana


Alignment Length:311 Identity:80/311 - (25%)
Similarity:144/311 - (46%) Gaps:34/311 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 GFGTDEDALINIICRRSNEQRQEIQRQFKTHFGKD-----------LIEDIKSETSGNFEKLLVG 272
            |.|.||:|||:.:.:...|.|:..::..|:.|.:|           .:..:|.|.|.....:::.
plant    19 GMGVDENALISTLGKSQKEHRKLFRKASKSFFVEDEERAFEKCHDHFVRHLKLEFSRFNTAVVMW 83

  Fly   273 LLRPIVDYYCAELNDAMAGLGTDEE---VLIEILCTLSNMEINTIKNQYLRLYGAHLESELKSET 334
            .:.|    :..:.......|...||   :::|:.||.|..::...:..|..|:...:|.::.|..
plant    84 AMHP----WERDARLVKKALKKGEEAYNLIVEVSCTRSAEDLLGARKAYHSLFDQSMEEDIASHV 144

  Fly   335 SGNFKRLLTSLCTAARDESGRVDPVAAKNDARELLKA----GELRVGTDESMFNMILCQRNYQQL 395
            .|..::||..|.:|.|.|..:|...:||:||:.|.:|    ||..|..||.:  .||..|:...|
plant   145 HGPQRKLLVGLVSAYRYEGNKVKDDSAKSDAKILAEAVASSGEEAVEKDEVV--RILTTRSKLHL 207

  Fly   396 KLIFQEYEGMTGHSLEKAIKKEFSGDVMEGLIAIYRCVTNKAEYFASRLHKAMAGIGTNDTQ--L 458
            :.:::.:..:.|..|...:.|  |..:.|.||    |:...|.||:..|..::.......|:  |
plant   208 QHLYKHFNEIKGSDLLGGVSK--SSLLNEALI----CLLKPALYFSKILDASLNKDADKTTKKWL 266

  Fly   459 IRVIITRSE--IDMTDIKVAFERLYGKSLKSWIKGDTSGHYKHALYALVGE 507
            .||.:||::  .:|.:||..:..|||::|...|:....|:|:..|..|:.:
plant   267 TRVFVTRADHSDEMNEIKEEYNNLYGETLAQRIQEKIKGNYRDFLLTLLSK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB11NP_001259616.1 Annexin 209..273 CDD:278615 15/64 (23%)
Annexin 280..345 CDD:278615 14/67 (21%)
Annexin 364..429 CDD:278615 20/68 (29%)
Annexin 439..504 CDD:278615 20/68 (29%)
ANNAT4NP_181409.1 Annexin 90..155 CDD:413385 14/64 (22%)
Annexin 245..314 CDD:413385 20/68 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0819
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D856254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.