DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB11 and anxa2b

DIOPT Version :9

Sequence 1:NP_001259616.1 Gene:AnxB11 / 32612 FlyBaseID:FBgn0030749 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001099070.1 Gene:anxa2b / 799806 ZFINID:ZDB-GENE-030131-1089 Length:338 Species:Danio rerio


Alignment Length:312 Identity:115/312 - (36%)
Similarity:182/312 - (58%) Gaps:1/312 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 PTVVPAANFDAVKDAHDLRKAMKGFGTDEDALINIICRRSNEQRQEIQRQFKTHFGKDLIEDIKS 260
            ||||.|.:|:...||..:..|:|..|.||..:|:|:.|||..||.:|..:::....|||:..:|.
Zfish    24 PTVVAAYDFNPEVDAAKIETAIKTKGVDEQTIIDILTRRSYLQRNDIAFEYEKRAKKDLVSALKG 88

  Fly   261 ETSGNFEKLLVGLLRPIVDYYCAELNDAMAGLGTDEEVLIEILCTLSNMEINTIKNQYLRLYGAH 325
            ..||:.|.|::||::....|...||..:|.|||||||.|||::|:.:..|:..||..|..::...
Zfish    89 ALSGSLEHLILGLMKSTPQYDAFELKASMKGLGTDEESLIEMVCSRNKEELAEIKKVYKEMFKKD 153

  Fly   326 LESELKSETSGNFKRLLTSLCTAARDE-SGRVDPVAAKNDARELLKAGELRVGTDESMFNMILCQ 389
            ||.::..:|||:|.:||.:|....|:| |..||.....||||.|.:.|..|.|||...:..|..:
Zfish   154 LEKDISGDTSGDFAKLLLALAQGKREEQSSVVDYEKIDNDARTLYETGVKRKGTDVVTWISIFSE 218

  Fly   390 RNYQQLKLIFQEYEGMTGHSLEKAIKKEFSGDVMEGLIAIYRCVTNKAEYFASRLHKAMAGIGTN 454
            |:...|:.:|:.|:..:.:.::::|:.|..||:.:..:.:..|:.||..||||||:.||.|....
Zfish   219 RSVSHLQKVFERYKRYSPYDIKESIRMEVKGDLEKSFLTLVECLENKHLYFASRLNDAMKGKSVK 283

  Fly   455 DTQLIRVIITRSEIDMTDIKVAFERLYGKSLKSWIKGDTSGHYKHALYALVG 506
            |..:.|:|::|.|:|:..:::.|:|.:|:||...|...|.|.|:.||..|||
Zfish   284 DKIITRIIVSRCEVDLMKVRIEFKRNFGRSLHQTISEHTKGDYQRALLNLVG 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB11NP_001259616.1 Annexin 209..273 CDD:278615 23/63 (37%)
Annexin 280..345 CDD:278615 27/64 (42%)
Annexin 364..429 CDD:278615 18/64 (28%)
Annexin 439..504 CDD:278615 26/64 (41%)
anxa2bNP_001099070.1 Annexin 37..101 CDD:278615 23/63 (37%)
Annexin 108..173 CDD:278615 27/64 (42%)
Annexin 193..258 CDD:278615 18/64 (28%)
Annexin 268..333 CDD:278615 26/64 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574823
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54302
OrthoDB 1 1.010 - - D500720at33208
OrthoFinder 1 1.000 - - FOG0000105
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X76
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.