DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB11 and ANXA8

DIOPT Version :9

Sequence 1:NP_001259616.1 Gene:AnxB11 / 32612 FlyBaseID:FBgn0030749 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_011538398.1 Gene:ANXA8 / 653145 HGNCID:546 Length:448 Species:Homo sapiens


Alignment Length:316 Identity:148/316 - (46%)
Similarity:204/316 - (64%) Gaps:2/316 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 REGTPTVVPAANFDAVKDAHDLRKAMKGFGTDEDALINIICRRSNEQRQEIQRQFKTHFGKDLIE 256
            :||. ||..:::|:...||..|.|||||.||:|.|:|:::.:|||.|||:|.:.||..|||||.|
Human   131 QEGV-TVKSSSHFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTE 194

  Fly   257 DIKSETSGNFEKLLVGLLRPIVDYYCAELNDAMAGLGTDEEVLIEILCTLSNMEINTIKNQYLRL 321
            .:|||.||.||:|:|.|:.|...|...||:|||.||||.|.|:||||.:.:..::..|...|...
Human   195 TLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEED 259

  Fly   322 YGAHLESELKSETSGNFKRLLTSLCTAARDE-SGRVDPVAAKNDARELLKAGELRVGTDESMFNM 385
            ||:.||.:::::|||..:|:|..|...:||: |..|||..|..||::|..|||...||||..|..
Human   260 YGSSLEEDIQADTSGYLERILVCLLQGSRDDVSSFVDPGLALQDAQDLYAAGEKIRGTDEMKFIT 324

  Fly   386 ILCQRNYQQLKLIFQEYEGMTGHSLEKAIKKEFSGDVMEGLIAIYRCVTNKAEYFASRLHKAMAG 450
            |||.|:...|..:|:|||.:...|:|.:||.|..|.:.|.::.:.:|..|...|||.||:.||.|
Human   325 ILCTRSATHLLRVFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYAMKG 389

  Fly   451 IGTNDTQLIRVIITRSEIDMTDIKVAFERLYGKSLKSWIKGDTSGHYKHALYALVG 506
            .||.|..|||.|::|||||:..||..|:::|||:|.|.|..||||.||:||.:|||
Human   390 AGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVG 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB11NP_001259616.1 Annexin 209..273 CDD:278615 37/63 (59%)
Annexin 280..345 CDD:278615 27/64 (42%)
Annexin 364..429 CDD:278615 27/64 (42%)
Annexin 439..504 CDD:278615 37/64 (58%)
ANXA8XP_011538398.1 Annexin 147..211 CDD:278615 37/63 (59%)
Annexin 218..283 CDD:278615 27/64 (42%)
Annexin 302..368 CDD:278615 27/65 (42%)
Annexin 378..443 CDD:278615 37/64 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141935
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0819
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54302
OrthoDB 1 1.010 - - D500720at33208
OrthoFinder 1 1.000 - - FOG0000105
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X76
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.