DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB11 and anxa5a

DIOPT Version :9

Sequence 1:NP_001259616.1 Gene:AnxB11 / 32612 FlyBaseID:FBgn0030749 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001107054.1 Gene:anxa5a / 557578 ZFINID:ZDB-GENE-080220-29 Length:316 Species:Danio rerio


Alignment Length:310 Identity:130/310 - (41%)
Similarity:200/310 - (64%) Gaps:2/310 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 TVVPAANFDAVKDAHDLRKAMKGFGTDEDALINIICRRSNEQRQEIQRQFKTHFGKDLIEDIKSE 261
            :|.|..:|:|..||..|||||||.|||||.::.::..|||:|||||:..:|..|||||::|::||
Zfish     6 SVKPFVHFNAKHDAEVLRKAMKGIGTDEDTILMLLAARSNDQRQEIKAAYKKAFGKDLVKDLRSE 70

  Fly   262 TSGNFEKLLVGLLRPIVDYYCAELNDAMAGLGTDEEVLIEILCTLSNMEINTIKNQYLRLYGAHL 326
            ..|..|.|:|.|:.|...|...||:.|:.|:||:::||||||.:.:..||..|...|.:.:|..|
Zfish    71 LGGKLEDLIVALMAPPTIYDANELHKAIKGVGTEDQVLIEILASRTCEEIKEIVKAYKKEHGGKL 135

  Fly   327 ESELKSETSGNFKRLLTSLCTAARDESGRVDPVAAKNDARELLKAGELRVGTDESMFNMILCQRN 391
            |.::..:|||:::::|..|..|.|:|.  ||....:.||:||..|||.:.||||..|..||..|:
Zfish   136 EKDIMGDTSGHYQKMLVILVQAGREEG--VDESRVEKDAKELFAAGEEKFGTDEDKFINILGNRS 198

  Fly   392 YQQLKLIFQEYEGMTGHSLEKAIKKEFSGDVMEGLIAIYRCVTNKAEYFASRLHKAMAGIGTNDT 456
            .:.|:.:|:.|:.:.|..:|:::|:|.:|::...|:|:.:|..:...|||..|.::|...||:|.
Zfish   199 AEHLRKVFEAYKKIAGCDIEESLKEECTGNLEALLLAVVKCAKSVPAYFAECLRESMRRAGTDDE 263

  Fly   457 QLIRVIITRSEIDMTDIKVAFERLYGKSLKSWIKGDTSGHYKHALYALVG 506
            .|||::::|||.||.||:.|:::.||.||.|.|:.||.|.|:.||..|.|
Zfish   264 TLIRIMVSRSERDMLDIRAAYKKKYGDSLYSTIQEDTDGDYQKALLYLCG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB11NP_001259616.1 Annexin 209..273 CDD:278615 35/63 (56%)
Annexin 280..345 CDD:278615 24/64 (38%)
Annexin 364..429 CDD:278615 24/64 (38%)
Annexin 439..504 CDD:278615 31/64 (48%)
anxa5aNP_001107054.1 Annexin 17..82 CDD:278615 35/64 (55%)
Annexin 89..154 CDD:278615 24/64 (38%)
Annexin 171..236 CDD:278615 24/64 (38%)
Annexin 246..311 CDD:278615 31/64 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574818
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0819
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54302
OrthoDB 1 1.010 - - D500720at33208
OrthoFinder 1 1.000 - - FOG0000105
OrthoInspector 1 1.000 - - mtm6419
orthoMCL 1 0.900 - - OOG6_100522
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X76
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.660

Return to query results.
Submit another query.