DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB11 and prnprs3

DIOPT Version :9

Sequence 1:NP_001259616.1 Gene:AnxB11 / 32612 FlyBaseID:FBgn0030749 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001013316.1 Gene:prnprs3 / 503702 ZFINID:ZDB-GENE-041221-3 Length:567 Species:Danio rerio


Alignment Length:223 Identity:67/223 - (30%)
Similarity:73/223 - (32%) Gaps:73/223 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PTSTNHHEPPRAPFGAGWVPPMQQNSPYPP----PSQPHPHSQPSSQMHPQQHQQYPGGAPAPYP 73
            |...|.:.||....|.|:  |.|  ..|||    |..|:..|.|....:|.|     ||.||   
Zfish    80 PQVPNQNPPPYPGAGGGY--PGQ--GRYPPAGSNPGYPNQGSYPGRAGYPNQ-----GGYPA--- 132

  Fly    74 PMSAPYPSAAPSYPP---YPTSNPYPAQYAPPAHNHYQQ---PSVSNSP----YPADRGY----- 123
              ...|| |...||.   ||....||||...||...|.|   |..|..|    |||..||     
Zfish   133 --QGGYP-AQGGYPAQGGYPAQGGYPAQGGYPAQGGYPQGNYPGRSGYPGQGGYPAQGGYPGGAS 194

  Fly   124 ----------------TPAMTAGYDAGYGYGNGQGHGQ-GHGHGQGHGH-GHGQ----------- 159
                            .|....|...||....|....| |.|.|...|: |..|           
Zfish   195 YPGAGAGSYPNRYPGGNPYPVGGSYPGYPVRGGSSPNQFGGGVGGAGGYPGAAQYPNWNPNNKIM 259

  Fly   160 GHEYGHGYGQGYGHG---------QGHG 178
            ...||..|| |||:|         ||.|
Zfish   260 SPAYGGNYG-GYGYGGRSPFAQSVQGMG 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB11NP_001259616.1 Annexin 209..273 CDD:278615
Annexin 280..345 CDD:278615
Annexin 364..429 CDD:278615
Annexin 439..504 CDD:278615
prnprs3NP_001013316.1 Bindin 118..>205 CDD:251078 30/97 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10502
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.