DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AnxB11 and ANXA10

DIOPT Version :9

Sequence 1:NP_001259616.1 Gene:AnxB11 / 32612 FlyBaseID:FBgn0030749 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_011529873.1 Gene:ANXA10 / 11199 HGNCID:534 Length:344 Species:Homo sapiens


Alignment Length:328 Identity:126/328 - (38%)
Similarity:191/328 - (58%) Gaps:21/328 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 TVVPAANFDAVKDAHDLRKAMKGFGTDEDALINIICRRSNEQRQEIQRQFKTHFGK--------- 252
            |:.||.||:.:.||..|..|::||..|:|.||||:.:|.|.||..|...:::.:|:         
Human    10 TIFPAPNFNPIMDAQMLGGALQGFDCDKDMLINILTQRCNAQRMMIAEAYQSMYGRAQCVLFSSM 74

  Fly   253 -----------DLIEDIKSETSGNFEKLLVGLLRPIVDYYCAELNDAMAGLGTDEEVLIEILCTL 306
                       |||.|::.:.|.:|:.::.||:.|...|...||..||.|:||||..|||||.:.
Human    75 CPCVLIIQLLLDLIGDMREQLSDHFKDVMAGLMYPPPLYDAHELWHAMKGVGTDENCLIEILASR 139

  Fly   307 SNMEINTIKNQYLRLYGAHLESELKSETSGNFKRLLTSLCTAARDESGRVDPVAAKNDARELLKA 371
            :|.||..::..|...|..:|:.::.|||||:|:..|.:|....|:| |..||..|..||..|.:|
Human   140 TNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREE-GYTDPAMAAQDAMVLWEA 203

  Fly   372 GELRVGTDESMFNMILCQRNYQQLKLIFQEYEGMTGHSLEKAIKKEFSGDVMEGLIAIYRCVTNK 436
            .:.:.|..::|..||||.::||||:|:|||::.::|..:..||.:.:.|...|.|:||..||.:|
Human   204 CQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINECYDGYFQELLVAIVLCVRDK 268

  Fly   437 AEYFASRLHKAMAGIGTNDTQLIRVIITRSEIDMTDIKVAFERLYGKSLKSWIKGDTSGHYKHAL 501
            ..|||.||:.|:...|.::..:||::|.|||||:..|:..::..|||||...|:...|||||.||
Human   269 PAYFAYRLYSAIHDFGFHNKTVIRILIARSEIDLLTIRKRYKERYGKSLFHDIRNFASGHYKKAL 333

  Fly   502 YAL 504
            .|:
Human   334 LAI 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnxB11NP_001259616.1 Annexin 209..273 CDD:278615 24/83 (29%)
Annexin 280..345 CDD:278615 28/64 (44%)
Annexin 364..429 CDD:278615 24/64 (38%)
Annexin 439..504 CDD:278615 29/64 (45%)
ANXA10XP_011529873.1 Annexin 22..>65 CDD:278615 17/42 (40%)
Annexin 113..178 CDD:278615 28/64 (44%)
Annexin 195..261 CDD:278615 24/65 (37%)
Annexin 271..336 CDD:278615 29/64 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141932
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0819
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4157
OMA 1 1.010 - - QHG54302
OrthoDB 1 1.010 - - D500720at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X76
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.670

Return to query results.
Submit another query.