DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 5PtaseI and SPAC9G1.10c

DIOPT Version :9

Sequence 1:NP_001138108.1 Gene:5PtaseI / 326119 FlyBaseID:FBgn0259178 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_593565.1 Gene:SPAC9G1.10c / 2542329 PomBaseID:SPAC9G1.10c Length:1191 Species:Schizosaccharomyces pombe


Alignment Length:292 Identity:67/292 - (22%)
Similarity:101/292 - (34%) Gaps:102/292 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 KGFMRTRWEINGTVIDLVNIHLFHDASNLAACEN-----------FPSVYCKTRRRALVHTIERF 222
            ||.:..|:.::.|...:||.||....||.||..|           ||               |..
pombe   933 KGAIVVRFLVDDTSYCIVNCHLAAGQSNKAARNNDLATILDNASLFP---------------END 982

  Fly   223 HLDEQNGTV------------PFFLFGDFNFRCDTEGVVKELTENLTPHRVQNVKNENDKIHYRN 275
            ..|:.|..|            ...|.||.|:|.:|          |.|..:..:| :||   .:.
pombe   983 ETDQLNTFVGGGDGSLIMDHEVCVLHGDLNYRINT----------LRPKALDLIK-KND---IKT 1033

  Fly   276 STGNNVLTVGKKEFSHADHQLKFKEDWLKKFDRELEPLKDVLVEYPIKFVPSYPFEEDPEMPTDY 340
            ...::.|.|.:|.  :|..:|:                  ...|..|.|.|:|.::...|.....
pombe  1034 LLQSDQLLVERKR--NAGFRLR------------------TFTEPEITFAPTYKYDVHSEQYDSS 1078

  Fly   341 MSTRCPAWCDRILM--SPQVNEIIQSDDWT-YGMIGEAVCMGDHKPVYLTVRLKPNKGTYRSCDC 402
            ...|.|||||||..  ||   :.|.::::| |.:..     .||:||...:..|           
pombe  1079 EKKRVPAWCDRICYRGSP---DYISAENYTRYELKA-----SDHRPVSALIHSK----------- 1124

  Fly   403 NYTNTYAKPNNIST--SPLPAVKLKYCPYSNK 432
                  ||..|..:  |....||.|:..|:::
pombe  1125 ------AKMVNAQSQGSTWDVVKRKWIEYADE 1150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
5PtaseINP_001138108.1 INPP5A 11..390 CDD:197326 58/246 (24%)
SPAC9G1.10cNP_593565.1 COG5411 281..794 CDD:227698
IPPc 787..1126 CDD:214525 59/266 (22%)
UBA_TAP-C_like 1161..1186 CDD:270459
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.