DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31102 and CG6830

DIOPT Version :9

Sequence 1:NP_001262951.1 Gene:CG31102 / 326118 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:434 Identity:143/434 - (32%)
Similarity:214/434 - (49%) Gaps:26/434 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PDNSNKFSASSDVRIPAWINEAYFKRLLKREFREFRRILNLSIIPATPPGETYTSLLMRIVIDIE 66
            |.|..:........:|.|:|:..|:.||..:..:|.:|:...:.||..|||.|.:|::||.||:|
  Fly    32 PPNKPEPEVDHSDLVPKWLNQTQFEELLAADVDQFSKIVGFRVKPAMAPGENYATLMLRISIDVE 96

  Fly    67 LKDGFSQQKSYIVKTMLDDAQGNGGFVNTLNIFPKEKMMYETIIPNLEQLYEEAGLSVKFAP--- 128
            |.|..::..|:::|...|..|.. ..::..|.|..|...|..|:|.:|:||:..||.:||||   
  Fly    97 LTDKSTKLVSFMMKVPHDTPQME-QMMSMANFFTSENAAYTEILPKMEELYKAKGLDIKFAPRAF 160

  Fly   129 KCHHAEDIKGRICLVQEDLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQRKGPFPDD 193
            |....::.|....::..||....::|||||:..::......|.:||:||||||...|..||:||.
  Fly   161 KLDATKEPKVANTVLMHDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVHGPYPDI 225

  Fly   194 FQRIYLPANYQK------------SKSYQARLQSYKTAIASWGLADHEQYVSRIPTA-DQFVQSY 245
            |....:..|.:.            ..|:.|.|..:|..         |:|..::..| ......:
  Fly   226 FVNGVMGNNKEAIIAFMEGMLASFRTSFMANLDKFKNG---------EEYREKLEKALAGLTMEF 281

  Fly   246 ASCFNNNPQEFKVLNHGDFWSSNIMLSYTQTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHS 310
            ......:|.||..|||||.|.:|::.....:||:..:.|||||..|:||||.||...||.|.:..
  Fly   282 MKLGIVDPNEFNALNHGDCWMNNLLFKMNSSGDLEDMVFVDFQNPKYGSPAMDLLYFIISSVQID 346

  Fly   311 IRIQYFDYFIRIYHTHLVRCLKILKYSERIPMLRELHMSMIKYGFWGYFTTFTHLVFILLPPDTE 375
            .::.:||:|||.|...||:.|.||.::.|.|.|||||.::||||.|..|.|.:.|..:||.|...
  Fly   347 YKLSHFDFFIRHYQEALVKHLGILGFTGRKPSLRELHRTLIKYGGWVLFPTISVLPLVLLDPTQS 411

  Fly   376 ASLVKLTQPGEEGDRFRSKVYTNPLYVRSALSIFPFLLRRGILD 419
            |:.........:|..||..:|.|.........|.|:|..||.|:
  Fly   412 ATFDNFMSDSADGVSFRGSLYANKRCQEYIERILPWLDNRGFLE 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 101/301 (34%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 101/301 (34%)
EcKinase 516..800 CDD:281023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442532
Domainoid 1 1.000 207 1.000 Domainoid score I6156
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.