DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31102 and JhI-26

DIOPT Version :9

Sequence 1:NP_001262951.1 Gene:CG31102 / 326118 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster


Alignment Length:299 Identity:61/299 - (20%)
Similarity:117/299 - (39%) Gaps:57/299 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 RIVIDIELKDGFSQQKSYIVK-------TMLDDAQGNGGFVNTLNIFPKEKMMYETIIPNLEQLY 117
            |..|:.|. ||...|:..:||       .|.:..|....|.|.:|       .|..|:|..::..
  Fly    60 RTTINFEY-DGQKFQRKMVVKKTPAMPPEMYESIQFGPLFTNEIN-------FYTEILPEFQKFT 116

  Fly   118 EEAGLSVKF-APKCHHAEDIKGRICLVQEDLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGA 181
            :.     || |||.::.|..:.....:.|:...:.:|......|..:.|....:..|..||....
  Fly   117 DG-----KFAAPKYYYGELNQHSAVAILENFAEQGWRVTKDRVGLSLQHAMIAVSYLGRFHGFAY 176

  Fly   182 VWRQRKGPFPDDFQRIYLPANYQKSKSYQARLQ-----SYKTAI--ASWGLADHEQYVSRIPTAD 239
            ..:.:.   |:.|.:  |..|.::|:.....:.     :.||:|  |:..:|.::..:.     :
  Fly   177 AMKHKN---PEKFAQ--LTDNLKESRYANDNIHPEWKLTMKTSIDRAAKAVATYQPQID-----E 231

  Fly   240 QFVQSYASCFNNN-----------PQE-FKVLNHGDFWSSNIMLSYTQTGDINQVRFVDFQLCKW 292
            :||:.:  ||..:           |:| ...|.|||:..:|:...|....:..::...|:|..:.
  Fly   232 EFVKKF--CFMISDYSQYGRQRVAPREPLATLCHGDYVRNNVAYRYDDKEEPQEIMMFDYQTLRV 294

  Fly   293 GSPAQDLWELIICSARHSIRIQYF-----DYFIRIYHTH 326
            .||..||...:..|....:|...|     :|.:.:::::
  Fly   295 SSPMVDLNVFLAVSIFAEVRDPNFEAIFCEYTLALHNSY 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 61/299 (20%)
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 61/294 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.