DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31102 and CG32195

DIOPT Version :9

Sequence 1:NP_001262951.1 Gene:CG31102 / 326118 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001262006.1 Gene:CG32195 / 317907 FlyBaseID:FBgn0052195 Length:401 Species:Drosophila melanogaster


Alignment Length:420 Identity:109/420 - (25%)
Similarity:178/420 - (42%) Gaps:54/420 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YFKRLLKREFR-EFRRILNLSIIPATPPGETYTSLLMRIVIDIELK-DGFSQQKSYIVKTMLDDA 86
            ||:|.|.|.:. |..|:.|..|...:..||.:.|::.|:.:..... ||..:...||:|.:|..|
  Fly    10 YFERALARAYGCEMLRVENFHIKAVSQKGENFCSVIYRVALVFRRSPDGALESGKYILKDLLPAA 74

  Fly    87 QGNGGFVNTLNIFPKEKMMYETIIPNLEQLYEEAGLSV---KFAPKCHHAEDIKGRICLVQEDLQ 148
            ...|         ..||.|:|.::|.::.:.|||...:   |.:..|...|...|:...:.|||.
  Fly    75 AALG---------TNEKDMFEVLLPAMQAILEEAPKEIGEHKLSADCLLVEISAGKELYILEDLG 130

  Fly   149 TKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQRKGPFPDDFQRIYLPANYQK--SKSYQA 211
            ...|.:.:|.:|.::......:.|||:||.|..|..::|   |:..||: .|::|..  :..:..
  Fly   131 ALGYESFDRRQGLNLEEAKICVRKLAQFHGASKVLYEKK---PELIQRL-SPSHYANGLNDRFAQ 191

  Fly   212 RLQSYKTAIASWGLADHEQYVSR-----IPTADQFVQSYASCFNNNPQEFKVLNHGDFWSSNIML 271
            .|.......|:...|:....:|:     ||.|  :.:......:.|......:.|||.|.:|||.
  Fly   192 ALVLEGAEYAAEAFAEELPEISKKMKAQIPKA--YTKRMRDVVDPNKSSLNAVIHGDPWLNNIMF 254

  Fly   272 SYTQTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIYHTHLVRCLKILKY 336
            .:..    .:...||||.|.|||||.||:.|...|.:..:.:...|..:..|..:|:..|:...|
  Fly   255 DFVN----KKATLVDFQNCYWGSPAIDLYFLFYTSLKPELLLNNQDELLNYYFDNLLETLRHCGY 315

  Fly   337 SERIPMLRELHMSMIKYGFWGYFTTFTHLVFILLPP------------DTEASLVKLTQPGEEGD 389
            .:.:|...:|...|.:..|:||:|....|......|            ||:|.|.|..|. ...:
  Fly   316 KDTLPTFGQLKDEMKRCLFYGYYTVVCELPICCASPEASVDFGVHTFVDTDAMLKKRHQL-FASE 379

  Fly   390 RFRSKVYTNPLYVRSALSIFPFLLRRGILD 419
            |.|..       :::.|.:|.   |.|||:
  Fly   380 RVRQT-------IKATLLMFD---REGILE 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 76/296 (26%)
CG32195NP_001262006.1 EcKinase 37..315 CDD:281023 76/296 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459473
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.