DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31102 and CG33301

DIOPT Version :9

Sequence 1:NP_001262951.1 Gene:CG31102 / 326118 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster


Alignment Length:421 Identity:112/421 - (26%)
Similarity:182/421 - (43%) Gaps:34/421 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IPAWINEAYFKRLLKREFREFR-RILNLSIIPATPPGETYTSLLMRIVIDIELKDGFSQQKSYIV 79
            :|.|:..||.:..|:...::.| ::|.:...|||..||.:..::.||.:|.:|.||....|:|||
  Fly     2 LPTWLTAAYLQPRLRAYCQDDRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNKTYIV 66

  Fly    80 KTMLDDAQGNGGFVNTLNIFPKEKMMYETIIPNLEQLYEEAGLSVKFAPKCHHAEDI---KGRIC 141
            |..|..............::.:|..|||.|:|.|::|.:||||..|..     |:.|   :....
  Fly    67 KQALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQEAGLDQKLT-----ADAITVDREYNT 126

  Fly   142 LVQEDLQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQRKGPFPDDFQRIYLPANYQKS 206
            ::.|||...|:.|.:|:|..||||....||.||:||||..|.::|   .|:...:.:....:.:.
  Fly   127 MILEDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQER---HPNLLTKCFYTHFFSRD 188

  Fly   207 KSYQARLQSYKTAIASWGLAD------------HEQYVSRIPTADQFVQSY-ASCFNNNPQEFKV 258
            |      ::|....|  ||..            .|.|..::......:..| |..::....:.|.
  Fly   189 K------KAYSVVFA--GLFKAFLRFIDGQPNLKEAYGDKLHKLRTHIMEYGARAYDVGESDLKT 245

  Fly   259 LNHGDFWSSNIMLSYTQTGDINQVRFVDFQLCKWGSPAQDLWELIICSARHSIRIQYFDYFIRIY 323
            |||||.|::|||..|...|:...|..:|||.....||..||......|.|..:..:..: .:..:
  Fly   246 LNHGDCWTTNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVGDKESE-LVEHH 309

  Fly   324 HTHLVRCLKILKYSERIPMLRELHMSMIKYGFWGYFTTFTHLVFILLPPDTEASLVKLTQPGEEG 388
            :..|...|:...|...:|.|:|..:...:..|............|....:..:....|.....||
  Fly   310 YKALKANLEKFSYKGSLPTLQEYRLQFERRRFMSLLAHMFKPCMIYNGSEETSDFSSLYAESPEG 374

  Fly   389 DRFRSKVYTNPLYVRSALSIFPFLLRRGILD 419
            .|::..||.:...:|||..:...|..:|:|:
  Fly   375 LRYQKSVYASEAVIRSATKLLAILDAKGLLE 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 84/301 (28%)
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 84/301 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459377
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.