DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31102 and C29F7.1

DIOPT Version :9

Sequence 1:NP_001262951.1 Gene:CG31102 / 326118 FlyBaseID:FBgn0051102 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001379235.1 Gene:C29F7.1 / 183016 WormBaseID:WBGene00007810 Length:394 Species:Caenorhabditis elegans


Alignment Length:226 Identity:48/226 - (21%)
Similarity:92/226 - (40%) Gaps:26/226 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LDDAQGNGGFVNTLNIFPKEKMMYETIIPNLEQLYEEAGLSVKFAPKCHHAEDIKGRI-CLVQED 146
            :|..:||...:..|.:...|...|     |:.:.|.:..:.|........|.|.:..: .:|.|.
 Worm    88 VDVNKGNAAAIMELFMHNTECNYY-----NVFRKYTDLPMKVPVIYCAAKAGDAEAPVPVIVMEM 147

  Fly   147 LQTKKYRNINRLKGFDMAHMHRVLEKLAEFHAAGAVWRQRKGPFPDDFQRIYLPANYQKSKSYQA 211
            .:.....::  :.|||...:.::::::...|.......:.:...||...|       .....::|
 Worm   148 FEDCTVHDL--IDGFDKDQLFKIVDEIVNLHIFSLTTEEWRSVLPDSAMR-------DTVDLFEA 203

  Fly   212 RLQSYKTAIA-SWGLADHEQYVSRIPTADQFVQSYASCFNNNPQEFK---VLNHGDFWSSNIMLS 272
            .:::....:| |.||....:|:.:....|   .|:.:.|::...|.|   ||.|||.||..|:..
 Worm   204 MVKTIAENMAKSPGLEIISKYIEKTFDKD---PSFMTKFSDEYLEGKRKSVLTHGDLWSPQILWD 265

  Fly   273 YTQTGDINQVRFVDFQLCKWGSPAQDLWELI 303
                .|.|....:|:|:...|||.:||..::
 Worm   266 ----KDDNIAGIIDWQVGHQGSPMEDLHRIL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31102NP_001262951.1 EcKinase 50..336 CDD:281023 48/226 (21%)
C29F7.1NP_001379235.1 CHK 142..322 CDD:214734 37/167 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.