DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and pkdc

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:224 Identity:45/224 - (20%)
Similarity:77/224 - (34%) Gaps:68/224 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 SFGPRAFRLDYSIGVQYVLLEDLKAKSYKNVERQAGFNKLCLKQVLKKLAQFHAASAVCVEKHGA 177
            |||..          |.::||||....:.  .|:...|...:|..|..:|.|||          .
Zfish   103 SFGEE----------QLIVLEDLDVAGFP--VRKTYVNDAEIKACLSWIANFHA----------L 145

  Fly   178 FSNLLVNGVYTKANESVLQELNDPEIFLSQLRRWRLGDHFHKRLVEKEKDL------------VD 230
            |.::...|:                        |.:|.::|.....:|.:.            :|
Zfish   146 FLDVTPEGL------------------------WPIGTYWHLETRPEELEAMSDQKLKAAAGEID 186

  Fly   231 GLLKLHSPDSNEFNVLNHSDCWVNNVMFKFDDSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAE 295
            .:|     ::..|..:.|.|..:.|..|..|..    ..|.:|:|.|..|....|:.|.:.|..:
Zfish   187 SIL-----NNCRFKTIVHGDAKLANFCFSKDGL----QVASVDFQYVGGGCGMKDVIYFLGSCMD 242

  Fly   296 KDIKLAQFDNMVQYYFYHLLDNL-KALNF 323
            :.....:...::.|||..|..:| |.::|
Zfish   243 ERECEKKAPGLLDYYFSELRKSLEKKVDF 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 44/222 (20%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 43/218 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589371
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.