DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and CG18765

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster


Alignment Length:418 Identity:109/418 - (26%)
Similarity:185/418 - (44%) Gaps:73/418 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IPDWVSSLSLNQAVHSVLEDGVQITSVIPSVHLIQFRNCTVL----LPIQVKVQLRDFTMKKLFF 66
            :|.||....|...|..:.|        ...:..::::..|.|    |.:.::|.:.|...:::.:
  Fly    16 LPTWVEKKELEALVKQISE--------FRKIESLRWKWETQLAEPALCVHIQVLVADNKKRQVSY 72

  Fly    67 LLKAQHGTDIQAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRL---------D 122
            |:|:.....: .:.:.:...|..|..::..|||.|||:|:...:.|.|||...:.         |
  Fly    73 LIKSPETVPV-GLKLPRTGDFSTERHMFEVVLPALEELYQNSDRIVHFGPPVIQAKLKSSHIYGD 136

  Fly   123 YSIGVQYVLLEDLKAKSYKNVERQAGFNKLCLKQVLKKLAQFHAASAVCVEK-HGAFSNLLVNGV 186
            |.:...|.:...||           |.:...::.||.|||.:||.:|..:.| .|....|.....
  Fly   137 YILNKGYSVANGLK-----------GLSVTAMEGVLSKLAAYHAGTAAYIAKTPGKIRELPKLRE 190

  Fly   187 YTKANESVLQELNDPEIFLSQLRRWRLGDHFHKRL----VEKEKDLVDGLLK--------LHSPD 239
            .:|::|.. .||..    |.|||       ||:.|    ..:.:|.|....|        |.|..
  Fly   191 NSKSDEET-AELKS----LYQLR-------FHESLRSNDARQYEDKVKSFQKYVKSGTEILDSKT 243

  Fly   240 SNEFNVLNHSDCWVNNVMFKFDDSGHVEDTALLDYQLVKYGSPAIDLYYTILSS-AEKDIKLAQF 303
            |  |||:.:..||.||::.:.|..|:|:||....:...:||....||:.::|:: |||.   ::|
  Fly   244 S--FNVILNGSCWPNNLLLQVDAFGNVKDTLFSGFHTAQYGPAVYDLFSSLLTAPAEKS---SRF 303

  Fly   304 DNMVQYYFYHLLDNLKALNFGGSLPQLQHIRDALNKNGLAAYVVVTRALPITMMNQFEDEVNERY 368
            |..|::|...|::||..|.|.|..|.|..::..|.|.|..|:...|..|||.:.:...:::.|  
  Fly   304 DGYVKFYHDQLIENLNLLKFLGKKPSLTDLQLDLLKYGHWAFETATEILPIVLSDFGNNDIEE-- 366

  Fly   369 ASKMKCAMFTSRKYIQAIKDILPWMEER 396
                   :|.:..:.:.|:::|||||.|
  Fly   367 -------LFRNPVFGEQIRELLPWMENR 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 82/305 (27%)
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 79/295 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442576
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26787
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.