DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and CG10559

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster


Alignment Length:404 Identity:119/404 - (29%)
Similarity:220/404 - (54%) Gaps:16/404 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IPDWVSSLSLNQAVHSVLEDG--VQITSVIPSVHLIQFRN-CTVLLPIQVKVQLRDFTMKKLFFL 67
            :|.|:.: :|.:.:.|....|  ..|.|..|...|....| .|::|.::::|:|:|.|::.:.::
  Fly    10 MPTWLRA-NLFEELLSKRYGGNYAGIKSFKPEAGLKPGENYSTIMLRLKLEVELQDHTIENVSYM 73

  Fly    68 LKAQHGTDIQAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRLDYSIGVQYVLL 132
            ||..:..::...::.:..||..|..|:..|:|:||::|::||.:|.||.:|:.:|  ....||||
  Fly    74 LKTPYDFEMYREILRKNNMFAVERDVFIQVIPELEQMYKDVGVEVKFGAKAYEID--APDDYVLL 136

  Fly   133 EDLKAKSYKNVERQAGFNKLCLKQVLKKLAQFHAASAVCVEKHGAFSNLLVNGVYTKANESVLQE 197
            :||....::||:|..|.:.:..|.||||:||:||.||..:...|.:....:...|....:..:::
  Fly   137 QDLGPLGFRNVDRLEGLDMVHTKCVLKKMAQWHAVSATRIHLKGPYPQNYLQPTYADTMKESIEQ 201

  Fly   198 LNDP--EIFLSQLRRWRLGDHFHKRLVEKEKDLVDGLLKLHSPDSNEFNVLNHSDCWVNNVMFKF 260
            :.:.  :.||..|..:...:.:...:.:.:..:||.:..:::||..:||.|||.|||.:|:|||:
  Fly   202 VAETLGKYFLKCLPLYEGYEEYSAAVHKMQPKIVDLMYAMNTPDPQDFNALNHGDCWTSNIMFKY 266

  Fly   261 -DDSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQYYFYHLLDNLKALNF- 323
             |:|....:|..:|.||.|..|.|.||.|.:|.|.:.:|:|:|||..::||..||:::|:.||: 
  Fly   267 EDESPEPIETYFVDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQFDYFIKYYHDHLVEHLRMLNYP 331

  Fly   324 GGSLPQLQHIRDALNKNGLAAYVVVTRALPITMMNQFEDEVNERYASK------MKCAMFTSRKY 382
            ....|.|..:...|.|.|...|.:.....|..::::.||.....:.::      :|.||:::.:|
  Fly   332 EAKTPTLGFLHTQLLKYGRVGYHIAFILCPPVLLDRTEDANLTDFVTETDNGDGLKLAMYSNARY 396

  Fly   383 IQAIKDILPWMEER 396
            .:.:..||.|:..|
  Fly   397 KKHVSAILKWLNNR 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 91/281 (32%)
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 92/286 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442559
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I6344
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101022at50557
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.