DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and CG31098

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_733091.1 Gene:CG31098 / 43057 FlyBaseID:FBgn0051098 Length:417 Species:Drosophila melanogaster


Alignment Length:395 Identity:85/395 - (21%)
Similarity:167/395 - (42%) Gaps:52/395 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PDWVSS---------------LSLNQAVHSVLEDGVQITSVIPSVHLIQFRNCTVLLPIQVKVQL 56
            |:|:::               |::.:.:....:.|.|.......:|...|.       :|     
  Fly    11 PEWLTAEFLQDVLKEHFKEEQLAVTELIVKSAQVGDQAAGFASEMHRASFN-------LQ----- 63

  Fly    57 RDFTMKKLFFLLKAQHGTDIQAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRL 121
            |....|..|.::...|.......|.::.|:|:||...|..|||:::.:.:.:|.:....|..:..
  Fly    64 RGTAPKGKFSVIVKDHPKGQTGAVAHRSKLFKREILAYKEVLPRIQALLQSIGDQTKIAPTCYYT 128

  Fly   122 DYSIGVQYVLLEDLKAKSYKNVERQAGFNKLCLKQVLKKLAQFHAASAVCVEKHGAFSNLLVNGV 186
            ..| ...:::|||::...::|.||....|...:...::|:|:.||.||:..:....        |
  Fly   129 TES-PEPFLILEDMQLSGFENFERGRLLNLDYVLPTIEKVAKLHACSALIAQDSPE--------V 184

  Fly   187 YTKANESVLQELNDPEIFLS-----------QLRRWRLGDHFHKRLVEKEKDLVDGLLKLHSPDS 240
            ....:|:.:....|...||:           ::..|:..:...:::....::::...|.:.....
  Fly   185 LEFFDEAPISRNPDRRDFLTFFPVNIRCVAEEVAHWKGYEEITEKMFNLAENVLQRALTMFESTG 249

  Fly   241 NEFNVLNHSDCWVNNVMFKF-DDSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFD 304
            .:|.|.|.:|.|:||::|.. :::...:|...||:||...|||.|||.|.:..|..::::...:.
  Fly   250 KDFRVFNLTDLWINNLLFHINNETKEPDDVVTLDFQLAYVGSPTIDLNYFLYGSLNENVRKVHYK 314

  Fly   305 NMVQYYFYHLLDNLKALNFGGSLPQLQHIRDALNKNGLAAYVVVTRALPITMMN--QFE--DEVN 365
            .:|:.|...|...|:.||:.|.:|.|:.|...|.|..|...:..|...|:....  .||  :::|
  Fly   315 YIVREYQRVLQQTLEKLNYQGHIPTLKEIHIELIKTSLMGVIGATCLTPLIFREGAGFENLEDLN 379

  Fly   366 ERYAS 370
            .|..|
  Fly   380 SRTES 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 63/290 (22%)
CG31098NP_733091.1 EcKinase 50..333 CDD:281023 65/303 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.