DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and CG13658

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster


Alignment Length:424 Identity:100/424 - (23%)
Similarity:183/424 - (43%) Gaps:61/424 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PDWVSSLSLNQAVHSVLEDGVQITSVIPSVHL--IQFRNCTVLLPIQVKVQLR----------DF 59
            |.|:::..:..|:.:..:|        |.:|:  ::....|:.......|..|          :|
  Fly    18 PAWLNAELIEGALRAYEKD--------PELHVTDLKISPATLQGDHYASVMFRAVSHYSTAKGNF 74

  Fly    60 TMKKLFFLLKAQHGTDIQAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVS-FGPRAFRLDY 123
            :...:...:..|.|.. :.|:.|. .:|:.|..:|...||:||.|.||.|.... :.|..:   :
  Fly    75 SKALIVKTMPEQEGHK-KDMLSNS-PIFKTEILMYSKALPELERILREAGDTTKLYAPCIY---H 134

  Fly   124 SIGV-QYVLLEDLKAKSYKNVERQAGFNKLCLKQVLKKLAQFHAASAVCVE---------KHGAF 178
            |:.. |.::.|||..:.| .|.|....||..|::...|||::||||...:.         |:|.:
  Fly   135 SLEPHQVMIFEDLVPQGY-TVIRDRYPNKEELQKAFFKLAKWHAASMKVLNERPDFLKEFKYGLW 198

  Fly   179 S--NLLVNGVYTKANESVLQELND-PEIFLSQLRRWRLGDHFHKRLVEKEKD----LVDGLLKLH 236
            .  |.|.:.:.|......|:.|:. ||:..            :|...||.||    .:..:::.:
  Fly   199 GMPNFLNDSIVTTGVPCFLEMLDKVPELTK------------YKPYFEKIKDNYIQQMSAVMEEY 251

  Fly   237 --SPDSNEFNVLNHSDCWVNNVMFKFD-DSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDI 298
              :|..|.:.||.|.|....|:||::: ::|..||..|:|:|:......:|||.|:|....:.:.
  Fly   252 RTNPKPNRYYVLCHGDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTED 316

  Fly   299 KLAQFDNMVQYYFYHLLDNLKALNFGGSLPQLQHIRDALNKNGLAAYVVVTRALPI--TMMNQFE 361
            :.......:.|||..|.|.||.:.|.|.:|....:.:.::.:....:.::|..||:  .|..:..
  Fly   317 RWDLGKEYINYYFSVLADTLKKIGFKGEMPTQTGVWEHIHGHKDYEFFMMTSFLPLVAAMNTKTF 381

  Fly   362 DEVNERYASKMKCAMFTSRKYIQAIKDILPWMEE 395
            ..::..:..:.|...|...:||..:|.:|...||
  Fly   382 KSMDSFFDPQTKQKSFFLDEYITDVKMLLRKFEE 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 79/309 (26%)
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 78/306 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459806
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.