DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and CG10514

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster


Alignment Length:430 Identity:106/430 - (24%)
Similarity:186/430 - (43%) Gaps:64/430 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PDWVSSLSLNQAVHSVLED-GVQITSVIPSVHLIQFRNC-TVLLPIQVKVQLRDFTMKKLFFLLK 69
            |:|::...:..|:....:| |:.||.:..:..|....|. .||...:|:..|.:........::|
  Fly     5 PEWLTHEYIEHALRCHYKDEGLTITQLQINPALGPGENYGGVLTRARVEFTLSNKEKNVQNLIVK 69

  Fly    70 AQHGTD-IQAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRLDYSIGVQYVLLE 133
            .:...| :...:|....::.||..:|..||||..|:..|:|......|.|..:|..  ...::.|
  Fly    70 TEIDDDELTQELMAPYDIYNREMTIYQEVLPKCRELLNEIGDTERIFPTAIYVDRE--RMAIIFE 132

  Fly   134 DLKAKSYKNVERQAGFNKLCLKQVLKKLAQFHAASAV-------CVEKH---------GAFSNLL 182
            ||....|...:|....|:.....:|:|||:||||:||       |:|.:         .|:|...
  Fly   133 DLSVVGYVMADRVRRLNEEHTHLILRKLAKFHAATAVLNERQSGCLESYDRGFFNRYTNAYSGYF 197

  Fly   183 VNGVYTKANESVLQELNDPEIFLSQLRRWRLG----DHFHKRLVEKEKDLVDGLLKLHSPDSNEF 243
            |.|:...|                   ||...    .|:.::|.......:|...:..:|...:.
  Fly   198 VGGLLAAA-------------------RWMSKVPTLAHYGEKLFALAPHYMDIGRECFAPTPGQV 243

  Fly   244 NVLNHSDCWVNNVMFKFD-DSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMV 307
            |||.|.|.|.||||||:| ::|...|..|:|:|...:|||.|||::...:|.::.::..|.:.:.
  Fly   244 NVLAHGDVWTNNVMFKYDPNTGRPVDVLLIDFQYSFWGSPCIDLHHLFNTSLKEPLRRDQQNGLF 308

  Fly   308 QYYFYHLLDNLKALNF-GGSLPQLQHIRDALNKN---GLAAYVVV---------TRALPITMMNQ 359
            |:|.....:.|:.||: ...:|.|...:..:.:.   .|.:.|||         |.|....:|| 
  Fly   309 QFYHKIFTETLEKLNYRQNQIPSLHQFKLEVEQKRFFALHSTVVVQPVMISQDPTDACFNALMN- 372

  Fly   360 FEDEVNERYASKMKCAMFTSRKYIQAIKDILPWMEERSLL 399
             :||...|:.::    ::.:....|.:..::|:.:.:.||
  Fly   373 -DDERGIRFKNR----LYNNPTVQQNLHSLVPFFDRKGLL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 79/301 (26%)
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 80/305 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459450
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.