DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and CG10513

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_651370.2 Gene:CG10513 / 43051 FlyBaseID:FBgn0039311 Length:422 Species:Drosophila melanogaster


Alignment Length:426 Identity:107/426 - (25%)
Similarity:194/426 - (45%) Gaps:54/426 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PDWVSSLSLNQAVHSVLED-GVQITSVIPSVHLIQFRNCTVLLPIQVKVQLRDFTMKK------- 63
            |:|:....|.:.:..:..| |::||.::......:..|..     .|..::|...:|.       
  Fly    16 PEWLDETYLERLLRDLKNDPGLRITDLVIKPATAKGDNYA-----SVMTRVRILFLKSGAKSPET 75

  Fly    64 LFFLLKAQHGTDIQAM-VMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRLDYSIGV 127
            .::::|..:..|..|. :.:|.::...|.::|..:||:|..:..:..:......:...:||.  .
  Fly    76 EYYIVKTTYENDAFASGIFSQYQVSTTEMRMYEKILPQLSSLIEKTRQPEKVFAKTLHVDYE--H 138

  Fly   128 QYVLLEDLKAKSYKNVERQAGFNKLCLKQVLKKLAQFHAASAVCVEK---------HG------- 176
            :.::.|||....|...:|..||:....:..|:|||:.|||:||..|:         ||       
  Fly   139 EAIIFEDLAVTKYVLADRLVGFDLEHTRLGLRKLAKMHAAAAVLNERQPGLLTKFDHGIFNRHTQ 203

  Fly   177 AFSNLLVNGVYTKANESVLQELNDPEIFLSQLRRWRLGDHFHKRLVEKEKDLVDGLLKLHSPDSN 241
            ||:...||.|...|:  ..:|.  ||          ||:.:..:|.:.::.:::...:::.|...
  Fly   204 AFAPFFVNTVGVAAD--FAREC--PE----------LGERYATKLKKLQERVMEYSTRVYDPQPG 254

  Fly   242 EFNVLNHSDCWVNNVMFKFDDSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNM 306
            :||.|.|.|.||||||.::.::....|..|:|:|...:.|||:||:|...:|.:.||:..|.|.:
  Fly   255 DFNTLVHGDYWVNNVMLRYGENKEPLDMTLIDFQFCSWSSPAVDLHYFFNTSVQVDIRYEQQDAL 319

  Fly   307 VQYYFYHLLDNLKALNFGGSLPQLQHIRDALNKNGLAAYVVVTRALPITMMNQFED-------EV 364
            .|||...|::.||.|||||.:|.|:.....|.:....|..|......|...:|..|       :.
  Fly   320 FQYYHTVLVETLKDLNFGGYIPTLRQFVLQLERGRFFAVTVALVCQAILTNDQNADADFNALMKD 384

  Fly   365 NERYASKMKCAMFTSRKYIQAIKDILPWMEERSLLN 400
            :|| ....:..::|:::....:|..||..:...||:
  Fly   385 DER-GRNFRKVLYTNKRLQDNLKRELPRFDRSGLLD 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 79/302 (26%)
CG10513NP_651370.2 EcKinase 50..336 CDD:281023 80/306 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459466
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.