DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and CG11889

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001287526.1 Gene:CG11889 / 3772506 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster


Alignment Length:357 Identity:94/357 - (26%)
Similarity:165/357 - (46%) Gaps:35/357 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 FLLKAQHG-TDIQAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRLDYSIGV-- 127
            ||||.... .|..|.::....::.||..:|..:||:|.:|   |..::....:.|..  ::||  
  Fly    72 FLLKTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADI---VKNELHDSRKLFAA--TVGVDR 131

  Fly   128 --QYVLLEDLKAKSYKNVERQAGFNKLCLKQ---VLKKLAQFHAASAVCVEKH-GAFSNLLVNGV 186
              ..::.|||..:.||...|   ..||.|:.   ||:|||.||||.|...::. |.|......|.
  Fly   132 ERDSIMFEDLSLERYKVACR---VKKLDLEHTYLVLEKLADFHAAGAALAQRQPGIFEKNYDRGF 193

  Fly   187 YTK---ANESVLQELNDPEIFLSQLRRWRLGDHFHKRLVEKEKDLVDGLL----KLHSPDSNEFN 244
            :.|   ..|.:::     .|..:..|...|.....:|...|...|:|.::    :..|....:|.
  Fly   194 FNKHVRGYEPIMK-----NILKALSRTLDLSPDLKERYQAKIDRLIDNVMDYGERSTSVAPGDFV 253

  Fly   245 VLNHSDCWVNNVMFKFDDSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQY 309
            .|.|.|.|..||||::||.||..:...:|:|...:.||||||.|...:|..::::|.:...:||:
  Fly   254 TLAHGDIWTTNVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTELVQF 318

  Fly   310 YFYHLLDNLKALNFGGSLPQLQHIRDALNKNGLAAYVVVTRALPITMMNQFEDEVNERYAS---- 370
            |||.|:..|:.:.:.|.:|.|...:......|..|........|..:.|..|:...|::.:    
  Fly   319 YFYKLVVALERVKYSGKVPSLFEFQQQFRTKGFYAVFASLIFEPTMVYNGKEEPSIEQFMTSDEK 383

  Fly   371 --KMKCAMFTSRKYIQAIKDILPWMEERSLLN 400
              :::.|::.:.:.::.:...||::::..||:
  Fly   384 GVRLRDAVYQTEENLKKLHLTLPFLDQLGLLD 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 80/272 (29%)
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 80/272 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459370
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.