DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and CG11891

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001027211.3 Gene:CG11891 / 3772439 FlyBaseID:FBgn0039309 Length:417 Species:Drosophila melanogaster


Alignment Length:441 Identity:102/441 - (23%)
Similarity:193/441 - (43%) Gaps:83/441 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IPDWVSSLSLNQAVHSVLEDGVQITSVIPSVHLIQFRNCTV-LLPIQVKVQLRD-----FTMKKL 64
            :|.|::...:.|.:.|                  .|||.:: |:.:.:|:.|.:     ..:.::
  Fly    12 VPAWLTRDYVEQKLRS------------------YFRNDSLRLVNLDIKLALGNGENYSSVITRI 58

  Fly    65 FFLLKAQHGTDIQ-------------AMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGP 116
            :.........|.|             |.|:....::.||..:|..:||::.|:.|   .:::...
  Fly    59 YVEYTTDKSKDKQSTRFTRFADAGPAAQVLLSYGVYNRELDLYERILPQMAEVVR---NELADSR 120

  Fly   117 RAFRLDYSIGVQYV-------LLEDLKAKSYKNVERQAGFNKLCLKQ---VLKKLAQFHAASAVC 171
            :.|     .|..||       :.||:..::|:..:|   ..||.|:.   ||:|||.||||.|..
  Fly   121 KLF-----AGTVYVDRKRDSIIFEDMSLENYRVADR---LKKLDLEHTHLVLEKLANFHAAGAAL 177

  Fly   172 VEKH-GAFSNLLVNGVY---TKANESVLQELNDPEIFLSQLRRWRLGDHFHKRLVEKEKDLVDGL 232
            .|:. |.|:.....|.:   |:..|.:::.|     .::..|...|.....:|...|...||:.:
  Fly   178 AERQPGIFAKNFDRGFFNQHTRGYEPIMKNL-----LMALSRSLELEPDLCQRYQAKIDRLVENV 237

  Fly   233 LKLHSPDS----NEFNVLNHSDCWVNNVMFKFDDSGHVEDTALLDYQLVKYGSPAIDLYYTILSS 293
            ::.....:    .:|..|.|.|.|..|:||::||.||..:...:|:|...:.||||||:|...::
  Fly   238 MEYGERSTTIVPGDFLTLAHGDLWTTNIMFQYDDKGHPINAIFIDFQFSAWNSPAIDLHYFFSTA 302

  Fly   294 AEKDIKLAQFDNMVQYYFYHLLDNLKALNFGGSLPQL----QHIRDALNKNGLAAYVVVTRALPI 354
            .:.||:|.:...:||:|:|.|...||.:.:.|::|.|    |..|   |::..||:..:.....:
  Fly   303 LQADIRLKKQPELVQFYYYKLNAALKKVQYSGNVPSLFVFHQQFR---NRSFYAAFASLIFEPTM 364

  Fly   355 TMMNQFEDEVNE-----RYASKMKCAMFTSRKYIQAIKDILPWMEERSLLN 400
            |...:.|..:::     ....:.|...|.:.:..:.::..||:::...||:
  Fly   365 TYTGKEEASMDQIISLSEKGMRFKDDAFQAEETRKKMRLTLPFLDHLGLLD 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 79/315 (25%)
CG11891NP_001027211.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.