DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and CG16898

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster


Alignment Length:429 Identity:92/429 - (21%)
Similarity:192/429 - (44%) Gaps:59/429 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IPDWVSSLSLNQAVHSVL-EDGVQITSVIPSVHLIQFRN-CTVLLPIQVKVQLRDFTMKKLFFLL 68
            :|:|::...|...:.:.. :|.:::..|.......:.:| .:::..|.|::|..|..::...:::
  Fly     2 LPNWLTEEYLQPKLRAYYKDDQLKVVKVWAKPATEKGQNYMSLMTRIHVEIQQGDGLLQNRTYII 66

  Fly    69 KAQHGTDI-QAMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRLDYSIGVQYVLL 132
            |.....|. ||.|..:..::.||..:|..:|||:.|:.:|||....|......:|..  .:.::|
  Fly    67 KESLSEDCPQAKVFLEYDVYNREMDMYEFILPKMNELLQEVGLTGKFTADTIFVDRE--YRTIIL 129

  Fly   133 EDLKAKSYKNVERQAGFNKLCLKQVLKKLAQFHAASAVCVEKHGAF--SNLLV------NGVYTK 189
            |||...:|.|.:|....:....|..|:.||:|||||.|..::|...  .:|.:      |..||:
  Fly   130 EDLAQYNYVNADRVKQLDLAHTKLTLEVLAKFHAASIVVKQRHPELLTKSLFIHCFSRDNKGYTE 194

  Fly   190 ANESVLQE----LNDPEIFLSQLRRWRLGDHFHKRLVEKEKDLVDGLLKLHSPDSNEFNVLNHSD 250
            ..|.||..    :|:..:         |...:..:|.:..::::|...:.......|...|:|.|
  Fly   195 VYEGVLSAFIRFINEQPV---------LKKKYGNKLQKIHENIMDYGARTFEVGEQELLTLSHGD 250

  Fly   251 CWVNNVMFKFDDSGHVEDTALLDYQLVKYGSPAIDL--YYTI-LSSAEKDIKLAQFDNMVQYYFY 312
            ||..|.::::||:.:.:....:|:|...:.||..||  ::|: |....:|::..    :|:.|:.
  Fly   251 CWTTNFLYQYDDASNPQSAVAIDFQFSNFTSPVNDLHQFFTVSLRDEVQDMESV----LVEKYYS 311

  Fly   313 HLLDNLKALNFGGSLPQLQHIRDALNKNGLAAYVVVTRALPITMMNQFE-------DEVNERYAS 370
            .|..|:..|::.|..|.||..:....          :|.....:.:.|:       .||:..::|
  Fly   312 DLKTNVDTLSYKGIFPSLQGFQKQFE----------SRRFMCLLAHLFKPVIIYDGTEVSSDFSS 366

  Fly   371 ---------KMKCAMFTSRKYIQAIKDILPWMEERSLLN 400
                     :.:.|::.:.:.:::...:|..::.:.:||
  Fly   367 VYKDTEEGIRFQKAIYANERVLKSATKLLAMLDAKGVLN 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 73/294 (25%)
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 74/299 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459402
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.