DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and JhI-26

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster


Alignment Length:296 Identity:56/296 - (18%)
Similarity:117/296 - (39%) Gaps:55/296 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 MFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRLDYSIGVQYVLLEDLKAKSYKNVERQAGFN 150
            :|..|...|..:||:.::.  ..||..:  |:.:..:.:......:||:...:.::..:.:.|.:
  Fly    97 LFTNEINFYTEILPEFQKF--TDGKFAA--PKYYYGELNQHSAVAILENFAEQGWRVTKDRVGLS 157

  Fly   151 KLCLKQVLKKLAQFHA-ASAVCVEKHGAFSNLLVNGVYTK-ANESVLQELNDPEIFLSQLRRWRL 213
            .......:..|.:||. |.|:..:....|:.|..|...:: ||:::     .||        |:|
  Fly   158 LQHAMIAVSYLGRFHGFAYAMKHKNPEKFAQLTDNLKESRYANDNI-----HPE--------WKL 209

  Fly   214 G-----DHFHKRLVEKEKDLVDGLLK---LHSPDSNEFN-----------VLNHSDCWVNNVMFK 259
            .     |...|.:...:..:.:..:|   ....|.:::.           .|.|.|...|||.::
  Fly   210 TMKTSIDRAAKAVATYQPQIDEEFVKKFCFMISDYSQYGRQRVAPREPLATLCHGDYVRNNVAYR 274

  Fly   260 FDDSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQYYFYHLLDNLKALNFG 324
            :||....::..:.|||.::..||.:||...:..|...:::...|:.:...|...|.::.:     
  Fly   275 YDDKEEPQEIMMFDYQTLRVSSPMVDLNVFLAVSIFAEVRDPNFEAIFCEYTLALHNSYR----- 334

  Fly   325 GSLPQLQH----IRDALNKNGLAAYVVVTRALPITM 356
                  :|    :.|.|::..|....|  |.||.::
  Fly   335 ------EHAKEEVPDFLSRGELLKEYV--RFLPYSL 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 48/257 (19%)
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 47/249 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.