DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and CG9259

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster


Alignment Length:406 Identity:87/406 - (21%)
Similarity:167/406 - (41%) Gaps:60/406 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TSVIPSVHLIQFRNCTVLLPIQVKVQLRDFTMKKLFFLLKAQHGTDIQAMVMNQLKMFQREHQVY 94
            ||..|:.:|.......|.|.:....::|..|    ||...|..|.:.:...:....:|::|..||
  Fly    41 TSDAPAGYLGSHLYLHVTLKLHNSEEVRQLT----FFSKSAPVGNESRMEYLEDFGVFEKEIAVY 101

  Fly    95 HNVLPKLEEIYREVGKKVSFGPRAFRLDYSIGVQYVLLEDLKAKSYKNVERQAGFNKLCLKQV-- 157
            .||||.|.:...||      .|:.:..|.::    ::.|:|..:.|:....:.|.  |..:|:  
  Fly   102 QNVLPDLHKACAEV------APKCYYADKNL----LIFENLADQGYRMGAGRDGL--LTYEQLHC 154

  Fly   158 -LKKLAQFHAASAVCVEKHGAFSNLLVNGVYTKANESVLQELNDPEIFLSQLRRWRLGD------ 215
             ||.||..||.|.:..::.|       ..:.....:||::.....::....:|.....:      
  Fly   155 CLKTLAAMHAGSIIQEQRTG-------QKIAQSQPKSVVENAYPSDVSPEHMRMVNFQNACLVLK 212

  Fly   216 HFHKRLVEKEKDLVDGLLK------------LHSPDSNEFNVLNHSDCWVNNVMFKFDDSGHVE- 267
            .|.| |:.|.:..:|.:|:            :.:.|..: |.:.|.|.|.||:||::...|.|. 
  Fly   213 EFIK-LIPKYQSKLDYVLENFTEKMSFIFEAVKTSDVYQ-NTILHGDLWANNIMFQYGRYGEVPL 275

  Fly   268 DTALLDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQYYFYHLLDNLKA--LNFGGSLPQ- 329
            ...|:|:||.:|..|.:|:...:.....|:.:.|....::..|:..:.:.||.  |:....:|: 
  Fly   276 QCRLVDFQLARYAPPVLDVLTVLTIPTSKEFRDAHLSELLAEYYRFMTEFLKRADLDIARFIPEQ 340

  Fly   330 -----LQHIRD-ALNKNGLAAYVVVTRALPITMMNQFEDEVNERYASKM--KC--AMFTSRKYIQ 384
                 :|..|. .|.::.|..::|:........:....|..|:.:.:|.  .|  |..|...|..
  Fly   341 TFYESVQKFRSVGLIESCLFCHLVILPPHCTQKLTSSVDGFNDFFTNKRIEICLEAFNTDELYRS 405

  Fly   385 AIKDILPWMEERSLLN 400
            .:.|::....::.::|
  Fly   406 RLVDMIEDFVDQFVIN 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 68/302 (23%)
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 66/295 (22%)
APH <252..325 CDD:279908 19/72 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459709
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.