DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and CG9498

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster


Alignment Length:333 Identity:84/333 - (25%)
Similarity:157/333 - (47%) Gaps:36/333 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 MFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRLDYSIGVQYVLLEDLKAKSYKNVERQAGFN 150
            :|.:|.|.|.:|||:|:.:.|  |.  :||.:.:. .....||.::..||..:.:|...|:.|.:
  Fly    98 VFIKEKQTYTDVLPRLDILSR--GD--TFGAKYYH-SVKTPVQTIVFSDLTVEGFKVASREKGLD 157

  Fly   151 KLCLKQVLKKLAQFHAASAVCVEKHGAFSNLLVNGVYTKANESVLQELNDPEI----FLSQLRR- 210
            ......:|::|.:|||.|.|..:|..|.......|:   .:|.:|.:.:..|.    ||..|.: 
  Fly   158 WNHASLILQQLGKFHATSMVLAKKDPAIVKQYTRGM---LSEDILMKSDTFEQMFGGFLKGLIKS 219

  Fly   211 ---W----RLGDHFHKRLVEKEKDLVDGLLKLHSPDSNEFNVLNHSDCWVNNVMFKFDDSGH--V 266
               |    ::..|. :||::..:::.....:....|  .:.||||.|.|.||.|:.:|::..  |
  Fly   220 SASWAGYEKISKHL-QRLMDNFRNVCADAPRPRKGD--RYVVLNHGDLWTNNFMYGYDNASQPDV 281

  Fly   267 EDTAL-LDYQLVKYGSPAIDLYYTILSSAEKDIKLAQFDNMVQYYFYHLLDNLKALNFGG--SLP 328
            ...|: :|:||..|||||.||.:.:.:|.:..:...:.:.:::.|:....|.|:...|..  |..
  Fly   282 PTRAIFVDFQLSFYGSPACDLNFFLNTSIKLQLLQERREELIKVYYASFKDALEYARFEDIPSYE 346

  Fly   329 QLQH---IRDALNKNGLAAYV-VVTRALPITMMNQFEDEVNERYASKMKCAMFTSRKYIQAIKDI 389
            .||:   .|:.....|:.|:: ::|....:...|..|:..:|.:..:...|:| |:|:   :.|.
  Fly   347 DLQYELRSRETYGLFGMFAFLPMITMPKELAQDNSIENMQDEAFKQRKMDAIF-SQKF---LNDH 407

  Fly   390 LPWMEERS 397
            ..|..:|:
  Fly   408 QKWALKRA 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 66/251 (26%)
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 66/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459236
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.