DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31099 and CG33510

DIOPT Version :9

Sequence 1:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster


Alignment Length:356 Identity:79/356 - (22%)
Similarity:138/356 - (38%) Gaps:84/356 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LFFLLKAQHGTDIQ-AMVMNQLKMFQREHQVYHNVLPKLEEIYREVGKKVSFGPRAFRLDYSIGV 127
            |:|..:.:...|:| :.:..:..:||..:.          |.|.|   |:....:..:|      
  Fly    62 LYFQYQLEDQKDVQTSRLFVKSVIFQNANM----------EFYME---KMGLIEKEIKL------ 107

  Fly   128 QYVLLEDLK--------AKSY---------KNVERQAGF----------NKLCLKQVLKKLAQFH 165
             |.||.:||        ||.|         :||| ..|:          |:..:..:||.||..|
  Fly   108 -YDLLNELKKFSKHVWSAKCYFTRKDLFVMQNVE-DMGYVALPPGTRFLNENQMGPILKSLATLH 170

  Fly   166 AASAVCVEKHGAFSNLLVNGVYTKANESVLQELN-DPEI--FLSQLRRWRLGDHFHKRLVEKEK- 226
            |:|....::.|.     ..||..:   ..|:|:: |||:  :.:.||........|..:::..: 
  Fly   171 ASSIAYEKQQGK-----TIGVEFR---KWLKEVSVDPEVEWYTTGLRAVLAVAAIHPDVLDNPEA 227

  Fly   227 ---------DLVDGLLKLHSPDSNEFNVLNHSDCWVNNVMFKFDDSGHVEDTALLDYQLVKYGSP 282
                     ..:|.:..:.:|.....||..|.|.|..|| |...:..|.|.:.|:|:||.:|..|
  Fly   228 QEYIAQELPRCLDKVYCMVNPSPVHRNVFVHRDAWNANV-FYHKEKPHEERSILVDFQLCRYSPP 291

  Fly   283 AIDLYYTILSSAEKDIKLAQFDNMVQYYFYHLLDNLKALNFGGSLPQL--QHIRDALNK------ 339
            |:|.:.....:.|...:.....::::.|:..|.:..:.:.......||  |....:||.      
  Fly   292 AMDFHLVTYLNLEPFSRKKMIGSLIETYYDALAEEFREMGVNPYQEQLSKQEFEQSLNDFSLFGA 356

  Fly   340 --NGLAAYVVVTRALPITMMNQFEDEVNERY 368
              |.:||.|:   .||...:...:||..|.:
  Fly   357 TYNCIAATVL---RLPDNYLKNLKDERPEDF 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 65/299 (22%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 46/204 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459707
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.